RetrogeneDB ID:
retro_mputfur_143
Organism:
Location:
GL896899.1:455874-456501 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.5 %
Coverage:
55.4 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ZFAND5
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger, AN1-type domain 5 [Source:HGNC Symbol;Acc:13008]

Genomic region (view in browser)





>retro_mputfur_143
ATGGCTCAAGAAACTAATCACAGCCAAGTGCCTATGCTTTGTTCCACTGGCTGCGGATTT
TATGGAAACCCTCGTACAAATGGCATGTGTTCAGTGTGCTATAAAGAACATCTTCAAAGA
CAGAATAGTAGTAATGGTAGAATAAGCCCACCTGCAGCCTCCGTCAGTAGCCTTTCGGAG
TCTCTCCCTGTCCAGTGCGTGGACGGTGGTGGCCCCGACGTTCAGTGCCCGCTGGACTCT
GCATGTGCGTCCGTGCAGCCAAGCCCTGTATCAAATCAGTCACTTTTATCAGAATCTGTA
GCATCTTCCCAAGTGGACAGTACATCTGTGGACAAAGCAGTACCTGACCCAGAAGACCTG
CAAGCTTCAGTATCAGATACGGCACAGCAGCCGTCTGAAGAGCAAAGCAAGTCTCTTGAA
AAACCAAAACAAAAAAAGAATCGCTGTTTCATGTGCAGGAAGAAGGTGGGACTTACTGGG
TTTGAATGCCGGTGTGGAAATGTTTACTGTGGTGTACACCGTTACTCCGATGTACACAAT
TGCTCTTACAATTACAAAGCTGATGCTGCTGAGAAAATCAGAAAAGAAAATCCAGTAGTT
GTTGGTGAAAAGATCCAGAAGATTTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PVTQQ--MTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQGEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAE
PV..Q....E...S.....T.....V..P...Q.S.S......S....K..E.PK.KKNRCFMCRKKVGLTGF.CRCGN..CG.HRYSD.HNC.Y.YKA.
Retrocopy
PVSNQSLLSESVASSQVDSTSVDKAVPDPEDLQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKAD


Parental protein
AAAKIRKENPVVVAEKIQRI
AA.KIRKENPVVV.EKIQ.I
Retrocopy
AAEKIRKENPVVVGEKIQKI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide