RetrogeneDB ID:
retro_mputfur_1434
Organism:
Location:
GL897134.1:640016-640360 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.95 %
Coverage:
67.63 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
GCSH
Parental gene aliases:
No gene alias available
Parental gene description:
glycine cleavage system protein H (aminomethyl carrier) [Source:HGNC Symbol;Acc:4208]

Genomic region (view in browser)





>retro_mputfur_1434
CATGAATGGATAACAACAGAAAGTGGTATCAGAACAATGAGATTCAGCAGTTTTGCACAG
GAAGCTTTGGGAGATGTTGTTTAATGTAGTCTCCTTAAAGGTGGGACAAAATTGAACAAA
CAAGAAGAGTTTGGTCCTTTGGAAAGTGTGGAAGCTGCTAGTGAACTCTATTCTCCACCA
TCAGGAGAAGTCACTGAAATTAATTGCAGAAAATCCAGGACTTGTCAACAAATCCTTTTA
TGAAGATGGTTGGCTGATCAAGGTAACACTCAGTAATCCTTCAGAATTAGAAGAATTAAT
GGGTAAAGAAGCATATAAAGAAATATATAAAATCTGTTGAGGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HEWITTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEA-LAENPGLVNKSCYEDGWLIKIALSNPSEL
HEWITTE.GI.T...S.FAQEALGDVV.CSL...GTKLNKQ.EFG.LESV.AASELYSP.SG...E..E...AENPGLVNKS.YEDGWLIK..LSNPSEL
Retrocopy
HEWITTESGIRTMRFSSFAQEALGDVV*CSLLKGGTKLNKQEEFGPLESVEAASELYSPPSG---EVTEI\IAENPGLVNKSFYEDGWLIKVTLSNPSEL


Parental protein
DELMSEEAY-EKYIKSIEE
.ELM..EAY..KYIKS.EE
Retrocopy
EELMGKEAY\KKYIKSVEE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide