RetrogeneDB ID:
retro_mputfur_1435
Organism:
Location:
GL897134.1:1305723-1306078 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.6 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
SKA2
Parental gene aliases:
No gene alias available
Parental gene description:
spindle and kinetochore associated complex subunit 2 [Source:HGNC Symbol;Acc:28006]

Genomic region (view in browser)





>retro_mputfur_1435
ATGGAAGCAGAGATCAATAAGATGGAACTTATGTTCAGAAAGCTGACTCTGATCTGGATT
ATATTCAGTACAGACTGGAATATGAAATCAAGACTAATCATCCTGATACAACAGGCAAGA
AAAATCCCTCTATACTCTTAAAAGAATTGTTAGCAATAAAGTCTCAATATCAAGCTTTGC
AAGCACACGTTAAACCAATTGCTGTCAAGCAGAAAGAGACTAAGAGCTGTGTTTGTGCTA
CTGTTCTTAATGACCATAACACAACACTACAAAGCAACCAGACCTGGGGCTATCACCATG
GACTAAAGAAGAGAAAACTGCAGCAGAGCAATTAAAGTCTCACACATCAGACTTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEAEVDKLELMF-QKADSDLDYIQYRLEYEIKTDHPVTAGKKNPVTLLKELSAIKSRYQTLHARFKSITTEQKETKNRICATVNKTMTMIQELQ-KQTDL
MEAE..K.ELMF.QKADSDLDYIQYRLEYEIKT.HP.T.GKKNP..LLKEL.AIKS.YQ.L.A..K.I....K......C............LQ.KQ.DL
Retrocopy
MEAEINKMELMF/QKADSDLDYIQYRLEYEIKTNHPDTTGKKNPSILLKELLAIKSQYQALQAHVKPIAV--KQKETKSCVCATVLNDHNTTLQ/KQPDL


Parental protein
ELSPLSKEEQTAAEQLKSFMSDL
.LSP..KEE.TAAEQLKS..SDL
Retrocopy
GLSPWTKEEKTAAEQLKSHTSDL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide