RetrogeneDB ID:
retro_mputfur_1436
Organism:
Location:
GL897135.1:643186-643997 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.79 %
Coverage:
83.03 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_mputfur_1436
CCACAAGGAGCGGCGGCCCAGGGGGGCCTCACATCGGCGGCGCCTGCCGGCAGGGACAAA
AAGGTCATCACAACAAAGGTTTGGGAATAGTAAAATGGTTCAATGTAAGAAATGGGCATG
GTTTCATCAGCAGGAAGGGCACCAAGGAAGACAGATCTGCATCACAGGCTGCCTGAGGGA
AGAAGAACTCCAGGAAGGGCCTTAGCAGTGGAGGAGACGGAGAGACTGTGGAGTCAGGTG
CTGTGGACGGAGAGAAGGGTGTGGAGACAGCAAACGCGGAGGGCCCCCCGGGGAGTCCAG
GGTGAGGCAGTAAGTCCGTGACAGACCCGAGCCGTTACACATGCTCTCCGCGTCGCAGGG
TCCTCCACGCAGTCACCAGCCAAATGACCAGAGCAGGGAGCATGCGGGAAGGACGCAGGA
TCGGAAAGTGCTCCCGAAGGCCAGGCCCAACAGCGCCGACCACACCTCAGGCGACGGTTC
CCGCCTTGCTCCTGCGGAGACCCTACAGCGCGGATTGCAGTAGGCCAACCCTCCCGAGCA
GGGAGAAGGGATGGGAGAAGGAATGGCAGGTGCGGACACCGGGGTGCACCAGAACAAGGT
AGTGAGACAGAACATGTATCGGGATTGAAGACCCCGATTCCGCAGGGGTCCTCCTCGTCA
AAGACAACCTAGAGAGGATGGCAACGAGGAAGATAAGGAAAATCAAGGAGATGAGACCCA
GGGTCAGCAGCCACCTCAACGTCACTACCACCGCAACCTCAGTTACCGACGCAGACACCC
AGAAAACCCTAAACCGCAAGACGGCAGAGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PHGALARGGTAGGAVAAPAGPDSKTLESLI-LGKVKWHQINNGWLFLRRLNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTG
P.GA.A.GG......AAPAG.D.K.......LG.VKW....NG..F..R...TKED....Q.A..K.N.RK.L.S.GDGETVE...V.GEKG.E.AN..G
Retrocopy
PQGAAAQGGLTS---AAPAGRDKKVITTKV/LGIVKWFNVRNGHGFISR-KGTKEDRSASQAA*GKKNSRKGLSSGGDGETVESGAVDGEKGVETANAEG


Parental protein
PGGVPVQGSKYAADRNHYRRYPRHR-GPPHNYQQNYQNSESGE-KNEGSESAPEGQAQQRRPYRRRRFPP-YYMRRPYG-RRPQYSNPPVQGEVM-EGAD
P.G.P..GSK...D...Y...PR.R.GPP...Q.N.Q..E....K..GSESAPEGQAQQRRP..RRRFPP....RRPY..R..Q..NPP.QGE.M.EG..
Retrocopy
PPGSPG*GSKSVTDPSRYTCSPRRR/GPPRSHQPNDQSREHAG/KDAGSESAPEGQAQQRRPHLRRRFPP/LLLRRPYS/RGLQ*ANPPEQGEGMGEGMA


Parental protein
NQGAG-EQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKE
....G..Q...VRQNMYR..RPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQR.Y.RN..YRRR.PENPKPQDG..
Retrocopy
GADTGVHQNKVVRQNMYRD*RPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRHYHRNLSYRRRHPENPKPQDGRD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide