RetrogeneDB ID:
retro_mputfur_1440
Organism:
Location:
GL897136.1:381637-381991 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.5 %
Coverage:
50.64 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
NAA38
Parental gene aliases:
No gene alias available
Parental gene description:
N(alpha)-acetyltransferase 38, NatC auxiliary subunit [Source:HGNC Symbol;Acc:20471]

Genomic region (view in browser)





>retro_mputfur_1440
CAGGCCTTTTTAGCTTCACTTGTCACCTGCATTGCTGTGTTGTCCAGAGCAGCTGAGCCC
AGCATTATGACATCTGCCTTGGAGAACTACATCAACCAAACTGTTGCATTTATTACTTCT
GAGGAGAGAATGGTTGTGCAAAGATTGCAATGTTTTAACCAGACCATTAACTTGAGTTTG
GATGAAAGTCATGAACTAGTATTCAGCCCTTCACAGGAGTAAAACAAGTGGTACTAGGGA
TACACATCATAACAAAGTCACAATATTGCACTCATTGGAGAAATTGCTGAAGAAACAAAT
CCTGCATTTGATTTGGGGACTATTCAAGCAGAACTTCTAAACTCTGTATCACAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RAFLAAVGASVLALFGAAGQSIMTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ-GVEQVVLGLYIV-RGDNVAVIGEIDEE
.AFLA........L..AA..SIMTSALENYIN.TVA.ITS..RM.V..L..F.QTINL.LDESHE.VFS.SQ.GV.QVVLG..I.....N.A.IGEI.EE
Retrocopy
QAFLASLVTCIAVLSRAAEPSIMTSALENYINQTVAFITSEERMVVQRLQCFNQTINLSLDESHELVFSPSQ/GVKQVVLGIHII\QSHNIALIGEIAEE


Parental protein
TDSALDLGNIRAEPLNSVAH
T..A.DLG.I.AE.LNSV.H
Retrocopy
TNPAFDLGTIQAELLNSVSH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide