RetrogeneDB ID:
retro_mputfur_1442
Organism:
Location:
GL897136.1:2215183-2215988 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
84.44 %
Coverage:
95.73 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
TRA2A
Parental gene aliases:
No gene alias available
Parental gene description:
transformer 2 alpha homolog (Drosophila) [Source:HGNC Symbol;Acc:16645]

Genomic region (view in browser)





>retro_mputfur_1442
ATGAATGATGTAGAGGAGAACAACTTCGAGGGCAGAGAGTCTCGCTCTCAGTCAAAATCT
CCAATGGGAACTACTGCTCGTGTAAAATCGGAGAGCAGGTCAGGGTTTTGTAGTCTCTCA
AGGATTTCCAAACACTCAGAATCCCATTCTTGATCAAGATCAAAATCCAGGTCGAGGTCA
AGGAGGCATTCTCATAGAGGTTACACTTGATCCAGATCCCATTCTCACTCTCATAGGAGA
CGATCTCGAAGTAGGTCATACACACCAGAATACTGGCGTTGAAGAAGCCAAAGTCATTCT
CCAATGTGTAACCGGAGAAGACATACAGGCAGCAGGGCAAATCCAGATCCCAACACTTGT
CCTGGAGGTGTTTGGCCTCATTTTATACACAACAGAGAGAGATCTTCGTGAAGTATTTTC
TCGATATGGACCACTGAGTGGTGTCAATGTGGTTTATGATCAGCAAACTGGTCGGTCACA
AGGATTTGCTTTTGTTTATTTTGAAAGAATAGATGACTCAAAGGAGGCTATGGAAAGGGC
AAATGTAATGGAGGTGGATGGTAGAAGAATTCGAGTGGATTATTCTATTACCAAGAGAGC
GCACACACCTACACCTGGCATCTACATGGGCAGACCAACTCATAGTGGTGGTGGCAGTGG
TGGAGGTGGTTGTGGAGGTAGAGGAGGTGGCAGGTATCGAGATTCTTACTATGACAGAGG
ATATGATCGTGGATATGACAGATATGAAGACTCTGATTACCGGTACAGAAGATCACCTTC
TCCTTACTATAGTCGGTACAGATCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKQSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHS
M.DVEENNFEGRESRSQSKSP.GT.ARVKSESRSG..S.SR.SK.SESHS.SRSKSRSRSRRHSHR.YT.SRSHSHSHRRRSRSRSYTPEY.R.RS.SHS
Retrocopy
MNDVEENNFEGRESRSQSKSPMGTTARVKSESRSGFCSLSRISKHSESHS*SRSKSRSRSRRHSHRGYT*SRSHSHSHRRRSRSRSYTPEYWR*RSQSHS


Parental protein
PMSNRRRHTGSRANPDPNTCLG-VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKR
PM.NRRRHTGSRANPDPNTC.G.VFGL.LYTTERDLREVFSRYGPLSGVNVVYDQ.TGRS.GFAFVYFERIDDSKEAMERAN.ME.DGRRIRVDYSITKR
Retrocopy
PMCNRRRHTGSRANPDPNTCPG\VFGLILYTTERDLREVFSRYGPLSGVNVVYDQQTGRSQGFAFVYFERIDDSKEAMERANVMEVDGRRIRVDYSITKR


Parental protein
AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGRRRDSYYDRGYDRGYDRYEDYDYRYRRRSPSPYYSRYRS
AHTPTPGIYMGRPTH..................RDSYYDRGYDRGYDRYED.DYRY.RRSPSPYYSRYRS
Retrocopy
AHTPTPGIYMGRPTHXXXXXXXXXXXXXXXXXXRDSYYDRGYDRGYDRYEDSDYRY-RRSPSPYYSRYRS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide