RetrogeneDB ID:
retro_mputfur_1445
Organism:
Location:
GL897137.1:1575493-1576337 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.67 %
Coverage:
99.65 %
Frameshifts:
6
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1445
GCCAGTGAAAAAGCTGAGAAGCCAGATACTAAGGAGAAGAAACCTGAAGCCAAGAAGGCT
ATGCTGGTGGCAAAGTTAAGGAGGGTAAGCTCAAGGCTAAAATGCCAAAGAAGGGGAAGC
CCCACTGCAGTAGAAACCCTGTCTAGTCGGAGGAATTAGCAGATAATCCCCATCAGTTAT
GCATTCTAGAAAGACCATGTACAAAAGGAAGTATTCAACAGCTAAATCCAGGGTTGAAAA
GAAGAAAGAGAAGGTTCTTGTTACTATCACAAAACCAGTTCATTGTGATAAGAAATGGCA
TTAGCGTAAACTTCCCCCAAATGCCTACGTATTACCCTACTGAAGATGTACCCTGAAACT
GTTGAGTCATGGCAAAAAACCTTTCAGTCAGCATGTGAGAAAACTTTGAACTAGCCTCAC
TCCTGGCCATTTTGATAGTCCTCACTGGGTGCCACAAAGGCAAGATTGTGGTTTTCCTGA
AGCAATGGAGCAGTGGCTTGTTACTTGTCACTGGATGTCTGGCCCTCAATTGAGTTCCTC
TACATAGAATACTCCAAAATTTCATCATTGCCACCTCCACCAAAATTGATATCAGCAATG
TGAAAAATCCCAACATCTCGCTGATGCTTATTTCAAGAAGAGGACTTATAAACCTAGACA
CCAGGAAGGTGAGATCTTCAACACTGAGAAGGAGAAATATGAGATTAATGAACAGTGCAA
GATTGATCAGAAAGCTGTGAACTTACAAATTCTGTCAGTAGTCAAAGCCGTTCTTCAGCT
TTAGGGCTACCTCTGCTCTATGTTTTCTTCCACAAATGGAATTAATCCTCACAAATTGGT
GTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGEKAEKPDTKEKKPEAKKTD-GGGKAKKGNKKAKTPKKGKPHCSRNPV-LVRGIGRYSRSAMYSRKAMYKRKYSAAKSRVEKKKKEKVLATVTKPVGGD
A.EKAEKPDTKEKKPEAKK....GGK.K.G..KAK.PKKGKPHCSRNPV.LV.GI.R.S.S.M.SRK.MYKRKYS.AKSRVEKKK.EKVL.T.TKPV..D
Retrocopy
ASEKAEKPDTKEKKPEAKKAM/AGGKVKEGKLKAKMPKKGKPHCSRNPV/LVGGISR*SPSVMHSRKTMYKRKYSTAKSRVEKKK-EKVLVTITKPVHCD


Parental protein
-KNGGTRVVKLRKMPRYYPTEDVP-RKLLSHGKKPFSQHVRKLRASITPG-TILIILTGRHRGKRVVFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIA
..NG....V....MP.YYPTEDVP..KLLSHGKKPFSQHVRKL..S.TPG.......TG.H.GK.VVFLKQ.SSGLLLVTG.L.LN.VPL.R..Q.F.IA
Retrocopy
\RNGIS--VNFPQMPTYYPTEDVP/LKLLSHGKKPFSQHVRKL*TSLTPG\ILIVL-TGCHKGKIVVFLKQWSSGLLLVTGCLALN*VPLHRILQNFIIA


Parental protein
TSTKIDISNVKIP-KHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKVDQKAVDSQILPKIKAVPQLQGYLRSVFSLTNGVYPHKLVF
TSTKIDISNVK.P..HL.DAYFKK....KPRHQEGEIF.TEKEKYEI.EQ.K.DQKAV..QIL...KAV.QL.GYL.S.FS.TNG..PHKLVF
Retrocopy
TSTKIDISNVKNP/QHLADAYFKKRTY-KPRHQEGEIFNTEKEKYEINEQCKIDQKAVNLQILSVVKAVLQL*GYLCSMFSSTNGINPHKLVF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide