RetrogeneDB ID:
retro_mputfur_1446
Organism:
Location:
GL897139.1:2216709-2217554 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
94.7 %
Coverage:
73.25 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
LDHA
Parental gene aliases:
No gene alias available
Parental gene description:
L-lactate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:C6L2F2]

Genomic region (view in browser)





>retro_mputfur_1446
GCCATCAGTATCTTAATGAAGGACTTGGCAGATGAACTTGCTCTTGTTGATGGCATGGAA
GACAAATTCAATGGAGAGATGATGGATCTCCAGCATGGAAGCCTTTTCCTTAGAACACCA
AAAATTGTCTCTGGCAAAGACTATAACGTGACTGCAAACTCCAAGCTGGTTATTATCACA
GCTGGGGCATGTCAGCAAGAGGGGGAAAGCCACCTTAATTTGGTCCAGCGTAACATGAAC
ATCTTTAAGTTCATCATTCCTAATGTCGTCAAATACAGCCAAACTGCAAGTTGCTTGTTG
TTTCCAATCCAGTGAATATCTTGACCTATGTGGCTTGGAAGATAAGTGGCTTTCCCAAAA
ACCGTGTTATTGGAAGTGGTTGCAATCTGGATTCAGCCCGGTTCTGTTACCTAATGGGAG
AAAGGCTGGGAGTTCACCCATTAAGCTGTCACGGGTGGATCCTCAGGGAGCATGGAGACT
CCAGTGTGCCTGTATGGAGTGGAGTAAACATTGCTGGTGTCTCTCTGAAGAATCTGCACC
CTGACTTAGGCACTGATGCAGATAAGGAACAGTGGAAAGAGGTTCACAAACAGGTGGTTA
ACAGTGCTTATGAGGTGATCAAACTGAAAGGCTTCACTTCCTGGGCCATTGGACTGTCTG
TGGCAGATTTGGCAGAAAGTATAATGAAGAATCTTAGGCAGGTGCATCCAATTTCCGCCA
TGATTAAGGGTCTCTATGGCATAAAAGATGATGTCTTCCTTAGTGTTCCTTGCATCTTGG
GACAGAATGGAATTTCAGATGTTGTGAAGGTGACTCTGACTCCTGAGGAAGAGGCCCGTT
TGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYS-PNCKLL
AISILMKDLADELALVD.MEDK..GEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGA.QQEGES.LNLVQRN.NIFKFIIPNVVKYS.PNCKLL
Retrocopy
AISILMKDLADELALVDGMEDKFNGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGACQQEGESHLNLVQRNMNIFKFIIPNVVKYS/PNCKLL


Parental protein
VVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNIAGVSLKNLHPDLGTDADKEQWKEVHKQV
VVSNPV.ILTYVAWKISGFPKNRVIGSGCNLDSARF.YLMGERLGVHPLSCHGWIL.EHGDSSVPVWSGVNIAGVSLKNLHPDLGTDADKEQWKEVHKQV
Retrocopy
VVSNPVNILTYVAWKISGFPKNRVIGSGCNLDSARFCYLMGERLGVHPLSCHGWILREHGDSSVPVWSGVNIAGVSLKNLHPDLGTDADKEQWKEVHKQV


Parental protein
VDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKDDVFLSVPCILGQNGISDVVKVTLTTEEEARLK
V.SAYEVIKLKG.TSWAIGLSVADLAESIMKNLR.VHPIS.MIKGLYGIKDDVFLSVPCILGQNGISDVVKVTLT.EEEARLK
Retrocopy
VNSAYEVIKLKGFTSWAIGLSVADLAESIMKNLRQVHPISAMIKGLYGIKDDVFLSVPCILGQNGISDVVKVTLTPEEEARLK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide