RetrogeneDB ID:
retro_mputfur_1448
Organism:
Location:
GL897140.1:768315-769196 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.32 %
Coverage:
66.36 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
ETF1
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation termination factor 1 [Source:HGNC Symbol;Acc:3477]

Genomic region (view in browser)





>retro_mputfur_1448
ATGGCAGATGACCTCAGTGCTGCCAACAGGAACATGGAGGTCTGGAAGATCAAGAAGCTC
ATCAGGAGCTTGGAGGCAGCCCACAGCAATGGGACAAGCATGATATCATTGATTATTCCT
CCCAAAGACCAGATTCCACCAGCTGCAAAAATGTTAGCAGATGAGTTTGGAACTGTATCT
AACATTAAGTCCCAAGTAAAATGTCTTTTAGTTCTGGGAGCCATTACATCTGTACAACAG
ATACACAAGCTTTAAACAAAGTACCTCCAAATGGCCTGGGTGTTTACTGGGGTACAATTG
TCACAGAAGGAGGAGAGGAAAAGAAAGTCAACATTGACTTTGAACCTTTCAAACCAATTA
ACACATCATTGTATTTGTGTGACAACAAATTCCATACAGAGGTTCTCACAGTGCTCCTTT
TGGATGACAGCAAATTTGGCTTCATTGTAATAGATGGTAGTGGTGCACTTTTTGGCACAC
TCCAAGGAAACACCAGAGAAGTCGTGCACAAATTCACTGTGGATCTCCCAAAGAAACATG
GTAGAGGAAGTCAATCAGCCTTGTGTTTTGCTCTTTTAAGAGTGGAAAAGTGACGTAGCT
ATGTTCAGAAAGTAGCTGAGACTGCTGTTCAGCTGCTTATTTCTGGGGACAAAGTGAATG
TGGCTGGTCTGGTTTTAGCTAAATCAGCTGACTTTAAAACTGAACTAAATCAATCTGATA
TGTTTGATCAGAGGTTGCAATCAAAAGTTTTAAAATTAGTTGATATTTCCTATGTTTGTG
AAAATAGATTCAACCAAGCTATTATGTACTGAAGCCCTCTCCAACGTGAAATTCATTCAA
GAGAAGATTTTGATGAAATCAGCCAGGACACAGGCAAGTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL-YNKVPPNGLVVYCGT
MADD.SAA.RN.E.WKIKKLI.SLEAA..NGTSMISLIIPPKDQI...AKMLADEFGT.SNIKS.V..L.VLGAITSVQQ..KL..NKVPPNGL.VY.GT
Retrocopy
MADDLSAANRNMEVWKIKKLIRSLEAAHSNGTSMISLIIPPKDQIPPAAKMLADEFGTVSNIKSQVKCLLVLGAITSVQQIHKL/LNKVPPNGLGVYWGT


Parental protein
IVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRH
IVTE.G.EKKVNIDFEPFKPINTSLYLCDNKFHTE.LT.LL.DDSKFGFIVIDGSGALFGTLQGNTREV.HKFTVDLPKKHGRG.QSAL.FA.LR.EK..
Retrocopy
IVTEGGEEKKVNIDFEPFKPINTSLYLCDNKFHTEVLTVLLLDDSKFGFIVIDGSGALFGTLQGNTREVVHKFTVDLPKKHGRGSQSALCFALLRVEK*R


Parental protein
NYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAI----ELSTEVLSNVKFIQEKKLIGRY
.YV.KVAETAVQL.ISGDKVNVAGLVLA.SADFKTEL.QSDMFDQRLQSKVLKLVDISY..EN.FNQAI.....L..E..S...F.......G.Y
Retrocopy
SYVQKVAETAVQLLISGDKVNVAGLVLAKSADFKTELNQSDMFDQRLQSKVLKLVDISYVCENRFNQAIMY*SPLQREIHSREDFDEISQDTGKY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide