RetrogeneDB ID:
retro_mputfur_1449
Organism:
Location:
GL897140.1:911523-911917 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.42 %
Coverage:
94.89 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
HRSP12
Parental gene aliases:
No gene alias available
Parental gene description:
heat-responsive protein 12 [Source:HGNC Symbol;Acc:16897]

Genomic region (view in browser)





>retro_mputfur_1449
CAGGTGATCAGCACTGCAAAAGCCCCCAGGGCCTTTGGTTCATGCCTACCGTCAAGCTGT
GTGAGTGGACAGGACCACTTACATTTCAACACAGTGAGGCATGGACCCTTCATGTGGATA
GCTAGTGCCAGGAGGGACGGCAGCAGAAGCCAAACAAGCTCCTATAAACACGGGTGAAAT
TCGGACAGCTGCAGGCTGTGACTTCACTCATGTGGTGAAAACAACTGTTTTGCTGGCTGA
CATGAATGACTTCGGTACGGCCGATGAAATGGACAAACAGCATTTCATGAGTCATCTTCC
TGTGAGAGCTGCTGCCCAGCTTGCCGCTTTGCCCAAAGGGGGCCTCGTGGAGACTGAAGC
AGTGGGTGACCAAGGACGTCTCACAACGGCATCG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KVISTAKA-PGA-IGPYSQAVLVDRTIYISGQLGMDPASGQLVPGGVAEEAKQALKNMGEILKAAGCDFSNVVKTTVLLADMNDFNTVNDVYKQYFKDSF
.VISTAKA.PG.....Y.QAV.VDRT.YIS.Q.GMDP..G.LVPGG.A.EAKQA..N.GEI..AAGCDF..VVKTTVLLADMNDF.T.....KQ.F....
Retrocopy
QVISTAKA\PGPLVHAYRQAV*VDRTTYISTQ*GMDPSCG*LVPGGTAAEAKQAPINTGEIRTAAGCDFTHVVKTTVLLADMNDFGTADEMDKQHFMSHL


Parental protein
PARAAYQVAALPKGGRVEIEAVAVQGPLTTAS
P.RAA.Q.AALPKGG.VE.EAV..QG.LTTAS
Retrocopy
PVRAAAQLAALPKGGLVETEAVGDQGRLTTAS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide