RetrogeneDB ID:
retro_mputfur_1450
Organism:
Location:
GL897141.1:400541-400846 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
66.36 %
Coverage:
92.98 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RPLP1
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein, large, P1 [Source:HGNC Symbol;Acc:10372]

Genomic region (view in browser)





>retro_mputfur_1450
CTCACCTGCATCTGCCTGGCCCTCACCCTGCAGGACGAAGAGGTCACAGAGCAAAGATCA
ATGCCCTCATTAGAACACCAGGTAGGACTGTTGAACCTCTCTTGCTGGGCTTGTTTGCAA
AGGCCCTGGGCAGTGTCAACATAGGAGCCTCAGCTGCCAACAGAGCGGCTGGGAGAGCTG
CCCCAGCACCTGGTGCTGTGCCAGCAGGAGGTCCTGCTCCTTCCACCGCTGCTCCAGCAG
AGAAGAAAATGGAAGCAAAGAAAGAAGAATCAGAGGAGTGTGATGATGGCATGGGCTCTG
GTCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LACIYSALILHDDEVTVTED-KINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESD
L.CI..AL.L.D.EV..TE..KINALI...G..VEP...GLFAKAL..VNIG....N..AG..APA.GA.PAGGPAPSTAA.PA.EKK.EAKKEESEE.D
Retrocopy
LTCICLALTLQDEEV--TEQ/KINALIRTPGRTVEPLLLGLFAKALGSVNIGASAANRAAGRAAPAPGAVPAGGPAPSTAA-PA-EKKMEAKKEESEECD


Parental protein
DDMGFGL
D.MG.GL
Retrocopy
DGMGSGL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide