RetrogeneDB ID:
retro_mputfur_1451
Organism:
Location:
GL897141.1:779095-779508 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.38 %
Coverage:
95.3 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
OSTC
Parental gene aliases:
No gene alias available
Parental gene description:
oligosaccharyltransferase complex subunit (non-catalytic) [Source:HGNC Symbol;Acc:24448]

Genomic region (view in browser)





>retro_mputfur_1451
GTCCCGTTCTTAATGCTTGAATGCCCAACGTGATGCAGAAGAAGCCGCACTGGGGGACAT
GGCGGCCACCATGATGGTGTATGCGCTGGTGGTGATGTCTTACTTCCTCATCACTGGAGG
AAAAATTTATGTTACCAACCCTCCAAGTGTTGGCTTTATGACCGACAAACATGGATGTCA
GAGACCAAGCTTTCTTGGCCATAAAGTAACTGGACAACATTACGGAAGGATTTGGCATCC
AGCTTCCTACTTAAAACAGGAGGTTCAGGTTTCTTAATCCTGGACCAATCGAATGTACCA
AACATTCCAAAACTCAATAGATTTCTTCTTCTATTCATTGAATTTGTCTGTATCCTATGG
AGTTTTTCATGGCTGGAGTATTCATGAGAATGGAACTGTTAAGCCATCTGATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VPFLVLECP-NLKLKKPPWV-HMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQY-IMEGLASSFLFTMGGLGFII
VPFL.LECP.N...KKP.W...M...M.VYALVV.SYFLITGG.IY.....PPSVG.MTD.HG.QRP..FL...V.GQ......LASSFL...GG.GF.I
Retrocopy
VPFLMLECP/NVMQKKPHWG/DMAATMMVYALVVMSYFLITGGKIY--VTNPPSVGFMTDKHGCQRP-SFLGHKVTGQH/LRKDLASSFLLKTGGSGFLI


Parental protein
LDRSNAPNIPKLNRFLLLFIGFVCVL-LSFFMARVFMRMKLPGYLM
LD.SN.PNIPKLNRFLLLFI.FVC.L...FFMA.VFMRM.L...LM
Retrocopy
LDQSNVPNIPKLNRFLLLFIEFVCIL/MEFFMAGVFMRMELLSHLM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide