RetrogeneDB ID:
retro_mputfur_1453
Organism:
Location:
GL897142.1:1713807-1714413 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.93 %
Coverage:
57.38 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
STX18
Parental gene aliases:
No gene alias available
Parental gene description:
syntaxin 18 [Source:HGNC Symbol;Acc:15942]

Genomic region (view in browser)





>retro_mputfur_1453
ATTTTGCACACTGGCAAGCTGAGAAGTTATTTCCTGGAACACAGGAAAGATTATATTAAT
GCTTATGGCCACCTCATGCCTGAATGTGGAAGGATGACATATGCAGAAAATCAGATAGAC
CAGGACGCTCAGACATTGGTGAGGATCTAATCAGAGCTAATTCAGCAACGAAACACACAA
GCCCACAGGAGATAATTTCCAGCAAGCACAGGAGTGCTATTTCGGATTTCACAGAAGGTT
ACTTTAAAACCATATACAAACTTTACTCAGGACAAAGAGTCACCGGATTTAAGCAAGTGG
TGATGAGAAAAAATTGGAACCAGAACCAAATACAAAGCCAAGAGAATCCACGTCTTCTGA
GAAAGTTCACAGAAACCTTCAAAATTCTCTGAAGGAAAAACCTGTCCCTGAGGAATATCC
AAACAAGACTCTGAGCAAAGCACAACCTGAATCCGGCTCCCGGAGAGACAGCCGAGGGGA
AATGAATTATTCCCAGAAGAAATACAAATGTTTGGAAAAGAAAATTAATGCCTAATCGGT
GAAATCAACAGCCTGTTGGATGAAGTGGGGCAATTCAAAGGAAAAGAGGTTGAAATTTCC
AGACTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQTFMRTCSEAIQQLRTQAHK-EIYSQQVKEHRSAVLDFVEDYLKRVCKLYSEQRAI
I.H.GKLR...LEHRKDYINAY.H.M.E.GRMT..E..QIDQDAQT..R..SE.IQQ..TQAH..EI.S.....HRSA..DF.E.Y.K...KLYS.QR..
Retrocopy
ILHTGKLRSYFLEHRKDYINAYGHLMPECGRMTYAE-NQIDQDAQTLVRI*SELIQQRNTQAHR/EIISSK---HRSAISDFTEGYFKTIYKLYSGQRVT


Parental protein
RVKRVV-DKKRLSKLEPEPNTKARESTSSEK-GSQHPSQESE-EKPATEEYPEKVPAESQPELGTWGEGKGD-DELSPEEIQMFEQENQRLIGEMNSLFD
..K.VV.D.K...KLEPEPNTK.RESTSSEK..SQ.PS..SE.EKP..EEYP.K.....QPE.G......G...EL.PEEIQMF..EN..LIGE.NSL.D
Retrocopy
GFKQVV/DEK---KLEPEPNTKPRESTSSEK/SSQKPSKFSE\EKPVPEEYPNKTLSKAQPESGSRRDSRGE/NELFPEEIQMFGKEN*CLIGEINSLLD


Parental protein
EVRQIEGRVVEISRL
EV.Q..G..VEISRL
Retrocopy
EVGQFKGKEVEISRL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide