RetrogeneDB ID:
retro_mputfur_1454
Organism:
Location:
GL897142.1:774767-775385 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
80.29 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
5


Parental gene:
Parental gene symbol:
RPL7
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L7 [Source:HGNC Symbol;Acc:10363]

Genomic region (view in browser)





>retro_mputfur_1454
ATGCTTTGAAAGGTGAAGAGGAAGCTTATCTATGATAAAGCTAAATATTAGCACAAAGAC
TATAGGCAGATGTACAGAACTGAGATTTAAATGGTGAGGATGGCAAGAAAAGCTGACAAC
TTCTGTGTACCTGCAGAACCCAAATTGGCACTTGTGTTTAGGATCAGAGGTATCAATGGT
GTGAGCCCAAAGGTTCAGAAAGTGTTGCAGTTTCTTCGCCAGATCTTCAGTGGCACCTTT
GTTAAACTCAACAGGGCTTTAGTTAACAAGCTAAGGATTGTGGAACCATACATAACATGG
GTGTACCATGCTATGAAGTTGGTGAATGAATTGATCTACAAGCGTAGTTATGGCAAAATC
AATAAGAAGTGAATTGCCCTGACAGATAACACATTGATTGCCCAGTCTCTTGGTAAATAC
AGCATCATCTGCAAGGAGGATCTGATTCACAAAGTCTATACTGTTGGAAAACGTTTCGAA
GAAACAAACAACTTTTTATGGCCCTTCAAATTATCTTCTCCGTAAGGGGAAATGAAGAAA
AAGACCACCCATTGTGTAGAAGGTGGAGATGCTGGCAACAGAGAAGACCAACTCAATAGG
GTTATTAGAAGGATGAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYI
ML.K..RKLIY.KAK..HK.YRQMYRTEI.M.RMARKA.NF.VPAEPKLA.V.RIRGINGVSPKV.KVLQ.LR..QIF.GTFVKLN.A.VN.LRIVEPYI
Retrocopy
ML*KVKRKLIYDKAKY*HKDYRQMYRTEI*MVRMARKADNFCVPAEPKLALVFRIRGINGVSPKVQKVLQFLR--QIFSGTFVKLNRALVNKLRIVEPYI


Parental protein
AWGYPNLKSVNELIYKRGYGKINKKRIALTDNTLIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQI
.W.Y...K.VNELIYKR.YGKINKK.IALTDNTLIA.SLGKY.IIC.EDLIH..YTVGKRF.E.NNFLWPFKLSSP.G.MKKKTTH.VEGGDAGNREDQ.
Retrocopy
TWVYHAMKLVNELIYKRSYGKINKK*IALTDNTLIAQSLGKYSIICKEDLIHKVYTVGKRFEETNNFLWPFKLSSP*GEMKKKTTHCVEGGDAGNREDQL


Parental protein
NRLIRRMN
NR.IRRMN
Retrocopy
NRVIRRMN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide