RetrogeneDB ID:
retro_mputfur_1455
Organism:
Location:
GL897142.1:1818806-1819321 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.55 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
TIMM17A
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of inner mitochondrial membrane 17 homolog A (yeast) [Source:HGNC Symbol;Acc:17315]

Genomic region (view in browser)





>retro_mputfur_1455
ATGGAGGAGTACACCTGAGAGCCTTGCCCTTGGCGAATTGTGGATGATTGTGGTGGAGTC
CTTTACGATGGGCAACATAGATGGTGGGACCTCTCAGACAATCAAGAATTTTTGCAATTC
TCCAGTGGGAGTAAACCACAGACTGTGAGGGAGTTTGACAGATATTAAAACCAGGGCTCT
GTGGTTGGGAGGTAACTTTGCAGTTTGGGGAGGTTTATTTTCCATGATTGACTGCAGTAT
GGTTCAAGTTAGAGGGAAAGAAGATCCCTGAAACTCCATCACAAGTGGTGCCTTATCAAG
GACACACACTGGCAGCAAGAAATGGACCAGTGGCTATGGCTGGGTCAGCTGCAATGGGCA
GCATTCTCCTAGCTTTAATTGAAGGTGCTGGTATCTTATTGACAGGATTTGCTTCATTAC
AATTTCCCAGTGGTCCTCAGTTTGCTGAAGGCCCCTCTTAGTTGCCTTCAGCCCAGTTAC
CATCCTCACTATCTGGAGATCATTGACAATATCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEEYAREPCPWRIVDDCGG-AFTMGTIGGGVFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGDKTGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSG
MEEY..EPCPWRIVDDCGG..FTMG.I.GG..Q.IK.F.NSPVGVNHRL.GSLT.IKTRA..LG...G.FAVWGGLFSMIDCSMVQVRGKEDP.NSITSG
Retrocopy
MEEYT*EPCPWRIVDDCGG\SFTMGNIDGGTSQTIKNFCNSPVGVNHRL*GSLTDIKTRALWLG---GNFAVWGGLFSMIDCSMVQVRGKEDP*NSITSG


Parental protein
ALT-GAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFTEDPSQLPSAQLPSSPFGDYRQYQ
AL..G..LAARNGPVAM.GSAAMG.ILLALIEGAGILLT.FAS.QFP.GPQF.E.PS.LPSAQLPSS..GD..QYQ
Retrocopy
ALS\GHTLAARNGPVAMAGSAAMGSILLALIEGAGILLTGFASLQFPSGPQFAEGPS*LPSAQLPSSLSGDH*QYQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide