RetrogeneDB ID:
retro_mputfur_1457
Organism:
Location:
GL897143.1:1642217-1642568 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.26 %
Coverage:
65.41 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
CBX1
Parental gene aliases:
No gene alias available
Parental gene description:
chromobox homolog 1 [Source:HGNC Symbol;Acc:1551]

Genomic region (view in browser)





>retro_mputfur_1457
GGAAAGAAACAAAACAAGAAAGTGGAGGAGGTCCTAGAGGATGAGGAAGAAGAATACGTG
ATGTAAACATTTCCCGATCATCGAGTGGAGAAGGCAAAGTGGAGAATTTCCTGAAGTGGA
AGGGGTCCTCAGATGCGGACGACACTTGGGAGCCACAAGAGAAGCTGGGCTGCACTGACC
TCACTGCCATTTCTACAGTCATAGAAAACACTACATGGGACAGAGAAATTATACAGGAAG
ACAAGTGCAAAATTGACTGATTCTGAAAATAAAGCAGAGAACAAACCAAAGAAGAAAGAA
GAGCCAGAAGAGCCATGAGACTCTGCCCAGGGTCTGGAGCTGGAGCAGATA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVK-GKVEYLLKWKGFSDEDNTWEPEENLDCPDLIA-EFLQSQK-TAHETDKSEGGKRKADSDSEDKGEES
GKKQNKK.VEEVLE.EEEEYV.....D.RV.K.GKVE..LKWKG.SD.D.TWEP.E.L.C.DL.A..F....K.T.H.T.K..........DSE.K..E.
Retrocopy
GKKQNKK-VEEVLEDEEEEYVM*TFPDHRVEK/GKVENFLKWKGSSDADDTWEPQEKLGCTDLTA/HFYSHRK/TLHGTEKLYRKTSAKLTDSENKA-EN


Parental protein
KPKKKKEESEKPRGFARGLEPERI
KP.KKKEE.E.P...A.GLE.E.I
Retrocopy
KP-KKKEEPEEP*DSAQGLELEQI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide