RetrogeneDB ID:
retro_mputfur_1458
Organism:
Location:
GL897143.1:456706-457191 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.24 %
Coverage:
87.36 %
Frameshifts:
1
Stop codons:
6


Parental gene:
Parental gene symbol:
ARL1
Parental gene aliases:
No gene alias available
Parental gene description:
ADP-ribosylation factor-like 1 [Source:HGNC Symbol;Acc:692]

Genomic region (view in browser)





>retro_mputfur_1458
GGATTCCATGGAACAGGAAAAACCATAATTTCATATAGGTTATAGGTTGGAGAAGTCATT
GCTACGATTCCTACTATTGGATTTAAAGTTGAGATGGTAACATACAAGAGCCTTGGATTC
CAACTCCAGGATTTAGGAGGACAGAAAAGTATCAGGCCATACTGGGGGTGTTATTTTTGC
ACATGTTAATATTGCACAGATGCAATCATTTCTGAGTAGGTAGTTGTGATGGAGACTGAA
CTGGCATTCCCAAATAAGAATTAGTTGCCATACTGGAGGAAGAAGAGTTGAGGAAATCCA
TTTTAGTGATGTTTGCAAGTAAATAGGACACCGAACAGGTCATGACTCTCTCAGAGATGG
CAAGTTTACTTGGGTTACCTGTGTGGAAGGATGGAAAATGGCAACTATTCAAAACTTCAG
CAGCCAAAAGCATTGGCCTTGATGAGGCAATGGAAGGGTTCACTGGAACATTAAAGAGAA
AACAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSN----TDAVI-YVVDSCDRDRIGISKSELVAMLEEEELRK
G..G.GKT.I.YRL.VGEV..TIPTIGF.VE.VTYK.L.FQ..DLGGQ.SIRPYW.CY.......TDA.I...V.SCD.D..GI.K.ELVA.LEEEELRK
Retrocopy
GFHGTGKTIISYRL*VGEVIATIPTIGFKVEMVTYKSLGFQLQDLGGQKSIRPYWGCYFCTC*YCTDAII/F*VGSCDGD*TGIPK*ELVAILEEEELRK


Parental protein
AILVVFANKQDMEQAMTPSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWXLVETLKSRQ
.ILV.FA.K.D.EQ.MT.SEMA..LGLP..KD.KWQ.FKTSA.K..GLDEAME.....TLK..Q
Retrocopy
SILVMFASK*DTEQVMTLSEMASLLGLPVWKDGKWQLFKTSAAKSIGLDEAME-GFTGTLKRKQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide