RetrogeneDB ID:
retro_mputfur_1459
Organism:
Location:
GL897145.1:934942-935195 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.53 %
Coverage:
92.31 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
LYRM4
Parental gene aliases:
No gene alias available
Parental gene description:
LYR motif containing 4 [Source:HGNC Symbol;Acc:21365]

Genomic region (view in browser)





>retro_mputfur_1459
ATGGCAGCCTCCAACTGTACACAATTGTTAGTTCTATACTAGGTGATGCAGAGAGAGAGC
AAGCATTTCAGCACCTACAATTATGGAACTTATATTGTCAGGAGAATAAAACATGGCTTC
AGAGAAGCTAAGAATGTAAAGGATCCTATAGAAATTCAAACCCTAGTGAATAAAGTCAAA
GGAGACATTGGAACAATTCATTGACCCGGTCTACTTCAGCCAACTGTATTTGACTGACAA
GCTTATCATTAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAASSRAQVLDLYRAMLRESKHFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQALVNKAKRDLGIIR-RQVLIGQMYSTDKLIIE
MAAS...Q.L.LY..M.RESKHFS.YNY.TY.VRRI...FRE.KNVKDP.EIQ.LVNK.K.D.G.I....V...Q.Y.TDKLII.
Retrocopy
MAASNCTQLLVLY*VMQRESKHFSTYNYGTYIVRRIKHGFREAKNVKDPIEIQTLVNKVKGDIGTIH\DPVYFSQLYLTDKLIIK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide