RetrogeneDB ID:
retro_mputfur_1460
Organism:
Location:
GL897145.1:2174377-2174575 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
82.35 %
Coverage:
51.16 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
TGIF2-C20orf24
Parental gene aliases:
No gene alias available
Parental gene description:
TGIF2-C20orf24 readthrough [Source:HGNC Symbol;Acc:44664]

Genomic region (view in browser)





>retro_mputfur_1460
TCTGTCTGGAGCAAGGTGCTGCAGAGCGATGCAGCCTGGGAGGACAAGGACGAATTTTTA
GATACAATCCGCTGGTTCCAACAGATCATCCCTGTAGTCCTAGGTGTCATTTGGGGAGTG
TTAACCATTGTGAGGTTTCCTGGGAATAGCAGGATTCTGCTGATCAGTGCAGGAGTCCTG
GACCTCTAATGCAGCAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVL-PLRGFLGIAGFC-LINAGVLYLYFSN
SVWSKVL.SDAAWEDKDEFLD.I.WF.QII.VVLGVIWGVL.PL.GFLGIAGFC.LI.AGVL.L..SN
Retrocopy
SVWSKVLQSDAAWEDKDEFLDTIRWFQQIIPVVLGVIWGVL\PL*GFLGIAGFC/LISAGVLDL*CSN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide