RetrogeneDB ID:
retro_mputfur_1468
Organism:
Location:
GL897150.1:110716-110985 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.53 %
Coverage:
73.77 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
AAMDC
Parental gene aliases:
No gene alias available
Parental gene description:
adipogenesis associated, Mth938 domain containing [Source:HGNC Symbol;Acc:30205]

Genomic region (view in browser)





>retro_mputfur_1468
ATGCCTTCCCCTAAAATTGCTTCCCTATCATGGGGGTAAATGAAATTACAAGGCTCTACT
AAAACCTGTAAGTCTACAAAGTGTGGCCAGGGGGAAGTCGGGCTTGGGATTGGAGAGATA
AAGAAACTGAGCATTCTCCTTTTATGTAGCCTGCAGATGTGGAGGAAGTTGTCAAGAAGG
GTGTGCAGACCCTAGTGACTGGCGGAGGGATGAGGGAGGCTTTGAAGGTGCCTCAATTAA
CTGCAAAGTGCCTGGCAAAACAAGGCATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSSPEIASLSWGQMKVQGSTKIYKDCK-VWPGGSRAWDWRETGTEHSPGVQPADVEEVVKKGVQTLVIGRGMSEALKVPPSTVEYLEKQGI
M.SP.IASLSWG.MK.QGSTK..K..K.VWPGGSRAWDWR...TEHSP...PADVEEVVKKGVQTLV.G.GM.EALKVP..T...L.KQG.
Retrocopy
MPSPKIASLSWG*MKLQGSTKTCKSTK/VWPGGSRAWDWRDKETEHSPFM*PADVEEVVKKGVQTLVTGGGMREALKVPQLTAKCLAKQGM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide