RetrogeneDB ID:
retro_mputfur_1469
Organism:
Location:
GL897150.1:168361-168897 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.77 %
Coverage:
50.28 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
HNRNPH3
Parental gene aliases:
No gene alias available
Parental gene description:
heterogeneous nuclear ribonucleoprotein H3 (2H9) [Source:HGNC Symbol;Acc:5043]

Genomic region (view in browser)





>retro_mputfur_1469
GGAAGTTATGGAGGTTTTGCTGACTATGGTGTCTATAATAATTATGGCTACAGAAATGAT
GGCTTTGATGACAGAATGAATGGAAAAGATATGGGAGGGCATGGCTATGGTGGAGCTGGT
GATGCAAGTTCGGGTTTTCATGGTGGTCATTTTGTACATATGAGAGGATTACCTTTTCAT
GCAACTGAAAATGACATTGCTAATTTCTTCTCACCACTAAATCTATTAAGAGTGCATAGT
GATATTGGAGCTGATGGCGGAGCAACAGGAGAGGTAGATGTAGAATTTGTGACACATGAA
GATGCTCTAGCTGCCATGTCTAATGATAAGAATAACATGCAACATCGGTACATTGAACTC
TTCTTGAATTCTACTCCTGGGGGCTGTTCTGGAATGGGAGGTTCTGGAATGGGAGGCTAT
GGCAGAGATGGAATGGATAATCAGGGAGGTTATGGATCTTTTGGAAGAATGGGAATGGGT
AACAATTAAGTGGAAGATATGGTGGTACTCCTGATGGCTTGGGTGGTTATGGCCGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVHMRGLPFRATENDIANFFSPLNPIRVHIDIGADGRATGEADVEFVTH
G.YGGF.DYG.YNNYGY.NDGFDDRM..G..MGGHGYGGAGDASSGFHGGHFVHMRGLPF.ATENDIANFFSPLN..RVH.DIGADG.ATGE.DVEFVTH
Retrocopy
GSYGGFADYGVYNNYGYRNDGFDDRM-NGKDMGGHGYGGAGDASSGFHGGHFVHMRGLPFHATENDIANFFSPLNLLRVHSDIGADGGATGEVDVEFVTH


Parental protein
EDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGSGMGGYGRDGMDNQGGYGSVGRMGMGNN-YSGGY-GTPDGLGGYGK
EDA.AAMS.DKNNMQHRYIELFLNSTPGG...........YGRDGMDNQGGYGS.GRMGMGNN..SG.Y.GTPDGLGGYG.
Retrocopy
EDALAAMSNDKNNMQHRYIELFLNSTPGGXXXXXXXXXXXYGRDGMDNQGGYGSFGRMGMGNN/LSGRYGGTPDGLGGYGR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide