RetrogeneDB ID:
retro_mputfur_1471
Organism:
Location:
GL897152.1:1122255-1122703 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.84 %
Coverage:
60.98 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
NIPSNAP3B
Parental gene aliases:
No gene alias available
Parental gene description:
nipsnap homolog 3B (C. elegans) [Source:HGNC Symbol;Acc:23641]

Genomic region (view in browser)





>retro_mputfur_1471
TTTGTTCATGGAACAGAAGTTCAGAAAGGTTTGACCAAAAATAAAGAAGGCTAGGAACAA
TTTCTCATTTCAAATTTGGCTGTCATTGATGAACAAGAGTTTGAGATTACTTATGTGGTA
CCATGGTCCAAAATAGAAAAACCTCCAAAGGGGTTCATGAACTGGTTGTTTTCCAGATGA
AACTTGATGGGCCAGCTCTGGGGGGGTGATCTGTCTAAGAGGGCAGTTAATGCCCCTCTA
GGTTTAAGCTACATAAAACCAACTGGTGTTCTCCACCCAGAATGAGGAGCAACCACTAGA
GTTTGCATTCTTTGGTGAAATGAGTGTGGATAGTCATGTAGCTGGAAGACAACAGTCTCG
TGAGAACCTCAGACTTGTGGTGGCTGTTTGGAAAAATGTCAACTACCAAGTGTCACAGCA
GAATATGCTTCCGATTCCTATGTCATTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FAHRTEVRKAVAKDKEW-QQSFIPNLGLTDKQEIEITYLVPWCKLE-KPAKEGVYELVSFQMKPGGPALWG-DAFKRAINAHVDLGYSKLIGVFHTEYGE
F.H.TEV.K...K.KE...Q..I.NL...D.QE.EITY.VPW.K.E.K..K.GV.ELV.FQMK..GPAL.G.D..KRA.NA...L.Y.K..GV.H.E.G.
Retrocopy
FVHGTEVQKGLTKNKEG*EQFLISNLAVIDEQEFEITYVVPWSKIE/KTSK-GVHELVVFQMKLDGPALGG\DLSKRAVNAPLGLSYIKPTGVLHPE*GA


Parental protein
LNRVHVLWW-NASADSRAAGRHQSHEDPRVVAAVRESVNYLVSQQNMLLIPTSF
..RV..L.W...S.DS..AGR.QS.E..R.V.AV...VNY.VSQQNML.IP.SF
Retrocopy
TTRVCIL-W\EMSVDSHVAGRQQSRENLRLVVAVWKNVNYQVSQQNMLPIPMSF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide