RetrogeneDB ID:
retro_mputfur_1474
Organism:
Location:
GL897154.1:950397-951490 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.73 %
Coverage:
67.09 %
Frameshifts:
8
Stop codons:
5


Parental gene:
Parental gene symbol:
LIN9
Parental gene aliases:
No gene alias available
Parental gene description:
lin-9 homolog (C. elegans) [Source:HGNC Symbol;Acc:30830]

Genomic region (view in browser)





>retro_mputfur_1474
ACTGTGGAGATGCCTTTCAGAAATTCAAAATGAGGTTGACTCTTTTCCAATGAAAATGAC
AGACAGATAAAAAATGGTAACCCAAAAGAAACAGGAAAGTTGCAATGGTCCCACCAAACT
TTACAGTGGACAATCACACCAGATAAGAAAGCCTCACAGAAGATTGGTTTCCAATTACAT
AACCAACTCAAGCTTCCCAAAGCACATAAATGGTGCATATATGAATGGTTCTATTCAACT
ATAGATAAACAACTGTTTGAAGGCTATGATGACTTCTGTGTCTTTCTGAAGGAATCCTTT
CCTAATTTAAAAACAAGAAAGTTACAAGGGTAGAATGGGGAATAATCAGGTGACTTATGG
GAAAATATGGAGACTTTCTTGTTCATGTTTTGAGGAAGAGAGACCAGCGTTAAAACAGAA
ACGACAGAAAATATGACTCTTACAAAAAAGGCAAGTTGCAGATGGTTCCCAGTTCAAAGA
TCTCCCAGATGAAATTCCTTTGCCCCTGTTTATTGGAACCAAAGTTATAGTTCGATTACG
TGGTGTTCATGATGGTCTCTTCATAGTTGCTGTGGATACTTTTAATCCTCCTTATAGAGT
AACTTTTGATAGGTAGGGCTTGGCAACCATACCATACCTGACTATGAAGTTCTTAGTAAT
GAGCTGCATGAGACGATGCCAGTTGCTGTCTTTGACAAAATCAGGGGCCTTCTTGATTCT
TTATGACTCCACCATGGTTACATTGCATTCCTCCCCTCCAGTCACCAATTAGGGATAATG
ATCCTGTACTAGCACAGTCACCTTGGAGAAGTAAGATTCCTGGCTCTGACACTGAAATGC
TAGGTCATTTTCCAGTACAATTCCTCATCCAAGTGAACACTTTGTCAAAAGTTCTCATGA
TTAAAAAGGGACATATCAAAAAATTAAGAGCAATGAACACAGAAGCAAAAAAATTGAAAT
CCTATTGCATGCCCATTGGCATTGAATTTCGGCAGAGTTATGCAACCATCATTCTGGAGC
TTGAGCAACTCAACAAGGACCTCGACAAAGTTTGCATGAAGTGCAGCACTGCTATGAGCC
TGCTCCATCCAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TVEMPFRNSKRSRLFSDEDDRQINTRSPK-RNQRVAMV-PQKFTATMS-TPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCL
TVEMPFRNSK...LFS.E.DRQI....PK.RN..VAMV.P.K.....S.TPDKKASQKIGF.L.N.LKLPKAHKWCIYEWFYS.IDK.LFEG..DFCV.L
Retrocopy
TVEMPFRNSK*G*LFSNENDRQIKNGNPK/RNRKVAMV/PTKLYSGQS/TPDKKASQKIGFQLHNQLKLPKAHKWCIYEWFYSTIDKQLFEGYDDFCVFL


Parental protein
KESFPNLKTRKL-TRVEWGKIRRLMGKPR-RCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGTKVTARLRGVHDGLFTGQIDA
KESFPNLKTRKL.TRVEWG.IR.LMGK...R.S...FEEER.ALKQKRQKI.LLQ.R.VAD.SQFKDLPDEIPLPL.IGTKV..RLRGVHDGLF...I.A
Retrocopy
KESFPNLKTRKL/TRVEWGIIR*LMGKYG/RLSCSCFEEERPALKQKRQKI*LLQKRQVADGSQFKDLPDEIPLPLFIGTKVIVRLRGVHDGLF---IVA


Parental protein
VDTFNATYRVTFDR-AGLGTHTIPDYEVLSNEPHETMPIAAFG-QKQRPSRFFMTPPRLHYTPPLQSPITDNDPLLGQSPWRSKISGSDTETLGGFPVEF
VDTFN..YRVTFDR..GLG.HTIPDYEVLSNE.HETMP.A.F..Q.Q.PS.FFMTPP.LH..PPLQSPI.DNDP.L.QSPWRSKI.GSDTE.LG.FPV.F
Retrocopy
VDTFNPPYRVTFDR/VGLGNHTIPDYEVLSNELHETMPVAVFD/QNQGPS*FFMTPPWLHCIPPLQSPIRDNDPVLAQSPWRSKIPGSDTEMLGHFPVQF


Parental protein
LIQVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVLELEQLNKDLNKV-LHKVQQYCYELAPDQ
LIQV..LSK.LMIKK.HIKKLR.MNTEA.KLKSY.MPIGIEF...YATI.LELEQLNKDL.KV.LH.V.Q.CYE.AP..
Retrocopy
LIQVNTLSKVLMIKKGHIKKLRAMNTEAKKLKSYCMPIGIEFRQSYATIILELEQLNKDLDKV/LHEV-QHCYEPAPSR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide