RetrogeneDB ID:
retro_mputfur_1475
Organism:
Location:
GL897155.1:454114-454684 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.06 %
Coverage:
90.48 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
HMGB2
Parental gene aliases:
No gene alias available
Parental gene description:
high mobility group box 2 [Source:HGNC Symbol;Acc:5000]

Genomic region (view in browser)





>retro_mputfur_1475
AAAAGCCAAGACAAAATGTCATCATATGCATTCTTTGTGCAAACTTGACTAGAGGAGTAC
AAGAAGAAGCATCCAGAAGCTTCAGTCAACTTCTCAGAGTTTTCTAAGAAGTGCTCAGAT
AGGTGGAAGACCATGTCTGCTAAAGAGAAAGAAAATTTGAAGACATGGCAAGGGTGGACA
AGGCCCGTTTTGAAAGAGAAATGAAAATTTATTTTCCTCCTTAAAGGGGAAACAAAAAAG
AAGTTCAAGGATCTCAGTGCACCCAAGAAGCCTCCTTTGGCCTTTTTCCTGTTTTGTTCT
GAGTATCACCCAAAAATCAAAGGAGAATATCCCAACCTATCCATTGGTGATGTTGCAAAG
AAACTGAGGGAAATGTGAAATAACACTGCTGCAGAAAAAAAGTAGCATTGTGAAAAGAAG
GCTGCTGAGCTGAAGAAAAAATATGAAAAGGATATTGCTGCATACGAAGCTAAAGGAAAG
TCTGATAGGGCAAAAAAAGGGAGTTGTCAAGGCTGAAAATAGCAAGAAAAAGAAGGAGAG
GAGGAAGATGAAGAAGAAGATGATGATAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKS-KFEDMAKSDKARYDREMKNYVPP-KGDKKGKKKDPNAPKRPPSAFFLF
K...KMSSYAFFVQT..EE.KKKHP..SVNF.EFSKKCS.RWKTMSAKEK..KFEDMA..DKAR..REMK.Y.PP.KG..K.K.KD..APK.PP.AFFLF
Retrocopy
KSQDKMSSYAFFVQT*LEEYKKKHPEASVNFSEFSKKCSDRWKTMSAKEKE/KFEDMARVDKARFEREMKIYFPP\KGETKKKFKDLSAPKKPPLAFFLF


Parental protein
CSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEE
CSE..PKIK.E.P.LSIGD.AKKL.EM.....A..K...E.KAA.LK.KYEKDIAAY.AKGKS...KKG.........K...E..EEE....
Retrocopy
CSEYHPKIKGEYPNLSIGDVAKKLREM*NNTAAEKK*HCEKKAAELKKKYEKDIAAYEAKGKSDRAKKGSCQG*K*QEKEGEEEDEEEDDDK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide