RetrogeneDB ID:
retro_mputfur_1477
Organism:
Location:
GL897155.1:160706-161163 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.71 %
Coverage:
84.92 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
ARL5A
Parental gene aliases:
No gene alias available
Parental gene description:
ADP-ribosylation factor-like 5A [Source:HGNC Symbol;Acc:696]

Genomic region (view in browser)





>retro_mputfur_1477
ATGGGAATTCTCTTCACCAGGATATGGAGGCTCTTCAATCACCAGGAGCACAAAATTATC
ATTGTTGGGCTGGATAATGCATGGGAAAATACCATCCTTTACCAATTATCTATGAATGAA
CTTATACATACATCACCTACAATAAGAAATAACATAGAAGAAATAGTGATTAATAATACA
CGTTTTCTAATGTGGGATACTGGTGGCCAAGAATCACTTTGGTCTTGGAACACTTATTAT
ACTAACACAGAGTTTGTAATAGTTGCTGTGAACAGTACAGACAGAGAAAGGATTTCTGTG
ACTAGGGAAGAACTCTATAAAATATTAGCCCATTAGGATCTACGGAAAGCTGGATTGCTG
ATTTTTGCTAATAAACAAGATGTTAAAGAAAGCATGACTAAAGCAGAAATCTCCCAGTTT
TTTGAAACTAACTACTTCTATTAAAGATCAACAGTGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERIS
MGILFTRIWRLFNHQEHK.IIVGLDNA...TILYQ.SMNE..HTSPTI..N.EEIVINNTRFLMWD.GGQESL..SWNTYYTNTEFVIV.V.STDRERIS
Retrocopy
MGILFTRIWRLFNHQEHKIIIVGLDNAWENTILYQLSMNELIHTSPTIRNNIEEIVINNTRFLMWDTGGQESL-WSWNTYYTNTEFVIVAVNSTDRERIS


Parental protein
VTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ-FLKL-TSIKDHQW
VTREELYK.LAH.DLRKAGLLIFANKQDVKE.MT.AEISQ.FLKL.TSIKD.QW
Retrocopy
VTREELYKILAH*DLRKAGLLIFANKQDVKESMTKAEISQ\FLKLTTSIKDQQW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide