RetrogeneDB ID:
retro_mputfur_1479
Organism:
Location:
GL897156.1:461923-462193 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.89 %
Coverage:
56.96 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL19
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L19 [Source:HGNC Symbol;Acc:10312]

Genomic region (view in browser)





>retro_mputfur_1479
ATGCTCAGACTTCAGAAGATGCTTGCTTCCAGTGTCCTCCTCTGTGGTAAAAAGAAGAGC
TGAAAAGACCTCAATGAGACCAGTGAAATCACCAAAGCCAACTCCCGTCAGCATGTCCAG
AAACTGATCAAAGATGGGTTGAGCATCTGGAACCCTGCGATGGTCCATTCCCGGGCTCGG
TGCCAGAAGAACACTATGGCCTGCCAGAAGGGCAGGCATATGGGCATCAGTGAGAGAAAA
GCTACTGCCAGTGCTTGAAAGTCTGAGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEK
MLRLQK.LASSVL.CGKKK...D.NET.EI..ANSRQ...KLIKDGL.I..P..VHSRARC.KNT.A..KGRHMGI..RK.TA.A...EK
Retrocopy
MLRLQKMLASSVLLCGKKKS*KDLNETSEITKANSRQHVQKLIKDGLSIWNPAMVHSRARCQKNTMACQKGRHMGISERKATASA*KSEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide