RetrogeneDB ID:
retro_mputfur_1482
Organism:
Location:
GL897158.1:205235-205911 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.01 %
Coverage:
54.99 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:UniProtKB/TrEMBL;Acc:G9KQ49]

Genomic region (view in browser)





>retro_mputfur_1482
TCAAAAAGACCGTCTTATGCCCCACTTCCCAACCCAGCTCCTGCAATACAAATGCTCAGC
ACACCAGGGTTTGTGGGATACAATCCATATAGTCGTCTCGCCTACAACCATATGTTCGGA
GGTAACCCAGGCACCCATGGCCAGGTCATGGCATCCTCTGTTATTATGATTTCAAAACCC
CCAAAGCCACCAAATAAACCAGTGTTGCCCTACATGAGGTACAGCAGAAAGGTCTGGGAT
CGAGTAAGAGCTTCCCATCTTGATCTAAACTTCTGGGAGATTGGCAAGATTATTGGTAGC
ATATGGCCAGATCTCACTCATGAAGAAAAATAAGAACATTTAAATAAGTATGAAACAGAA
AAGATAGAGTACAATTAATCTTTGAAGGCCTATCATAATTCCCCCACATACCTTGCTTAC
ATAAATGCAAAAAGTTATGCAGAAGCTGCTTTAGAGGAAGAAAGTGTACAGAGACAGACT
TGCATGGAGAAAGGAGAACCTTACATGAATATTCAGCCTGCTGAAGATCCAGTTGATTAC
AATGATAGCTTTTCAGTGAAGTGTATAAGCCACCACCCATTTCCAGGGAAACCACCACCT
TATCATTGAAATCCTTAGTGAGAGTGTGGTGCCAGATGTTCATTTGCTTGTCACAACAGC
TAGAATGTAGGTCCTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TERPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIG
..RPSYAP.P.PAPA.QM.STPGFVGYNPYS.LAYN....GGNPGT...V.ASS.I.I.KPPKPP.KP..PYMRYSRKVWD.V.AS..DL..WEIGKIIG
Retrocopy
SKRPSYAPLPNPAPAIQMLSTPGFVGYNPYSRLAYN-HMFGGNPGTHGQVMASSVIMISKPPKPPNKPVLPYMRYSRKVWDRVRASHLDLNFWEIGKIIG


Parental protein
GMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSHAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHT-ATARFQRNH
..W.DLT.EEK.E.LN.YE.EKIEYN.S.KAYHNSP.YLAYINAKS.AEAALEEES.QRQ..MEKGEPYM.IQPAEDP.DY.D.FS.K...AT..FQ.NH
Retrocopy
SIWPDLTHEEK*EHLNKYETEKIEYN*SLKAYHNSPTYLAYINAKSYAEAALEEESVQRQTCMEKGEPYMNIQPAEDPVDYNDSFSVKCI\ATTHFQGNH


Parental protein
RLISEILSESVVPDVRSVVTTARMQVL
.LI.EILSESVVPDV...VTTARM.VL
Retrocopy
HLIIEILSESVVPDVHLLVTTARM*VL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide