RetrogeneDB ID:
retro_mputfur_1483
Organism:
Location:
GL897159.1:1895247-1895918 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
88.05 %
Coverage:
67.57 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1483
CACCTGAAGGGTGGGGCCAAGAGGGTCATCATCTCCACTCCTTCTGCTGATGCCCCCATG
TTCATGATGGGTGTGGACCATGAGAAATACAACTCCCTCAAGACTGTCAGCAATGCCTCC
TGTACCACCAACTGCTTGGCTCCTCTGGCCAAGGTCATCCATGACAACTTTGGCATCAAG
GAGGGTCTCATGACCACCGTCCATGCCTTCACTGCCACCCAGAAGACTATGGATGGCCCC
TCTGGGAAGCTGTGGCATGACGGCCGAGGAGCTGCCCAGAACATCATACCTGCTTCCACT
TGTGCGGCCAAGGCTGTAGGCAAGGTCATCCTGAGCTGAACTGGAAACTCCCTGGCATGG
CCTTCCACGTCCCCACCCCCAGCATGTTTGTCGTGGATCTGACCTGCCTTCTGGAGAAAG
CTGCCAAATATGATGACATCAAGAAGGTGGTGAAGTAGGCATCAGAGGACCCCCTCAAGG
GCATCCTGGGGTACACTGAGGATCAGGTTGTCTCCTGCGACTTTAACAGTGACACCCAGT
CTTCTACCTTTGATGCCGGGACTGGCGTTGCTCTCAATGACCACTCTGTCAAGCTCATTT
CCTGGTATGACAATGAATTTGGCTACAGCAACCAGGTGGTGGACATTATGGTCCACATAG
CCTCCAAGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPAS
HLKGGAKRVIIS.PSADAPMF.MGV.HEKY.NSLK.VSNASCTTNCLAPLAKVIHDNFGI.EGLMTTVHA.TATQKT.DGPSGKLW.DGRGAAQNIIPAS
Retrocopy
HLKGGAKRVIISTPSADAPMFMMGVDHEKY-NSLKTVSNASCTTNCLAPLAKVIHDNFGIKEGLMTTVHAFTATQKTMDGPSGKLWHDGRGAAQNIIPAS


Parental protein
TGAAKAVGKVI-PELNGKLTGMAFRVPTPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVK
T.AAKAVGKVI.PELN.KL.GMAF.VPTP...VVDLTC.LEKAAKYDDIKKVVK.ASE.PLKGILGYTEDQVVSCDFNSDT.SSTFDAG.G.ALNDH.VK
Retrocopy
TCAAKAVGKVI/PELNWKLPGMAFHVPTPSMFVVDLTCLLEKAAKYDDIKKVVK*ASEDPLKGILGYTEDQVVSCDFNSDTQSSTFDAGTGVALNDHSVK


Parental protein
LISWYDNEFGYSNRVVDLMVHMASKE
LISWYDNEFGYSN.VVD.MVH.ASKE
Retrocopy
LISWYDNEFGYSNQVVDIMVHIASKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide