RetrogeneDB ID:
retro_mputfur_1485
Organism:
Location:
GL897160.1:2012318-2012745 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.62 %
Coverage:
87.27 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
CFL1
Parental gene aliases:
No gene alias available
Parental gene description:
cofilin 1 (non-muscle) [Source:HGNC Symbol;Acc:1874]

Genomic region (view in browser)





>retro_mputfur_1485
TCCTCAACACCAGAGGAGGTGAGAAGTGCAAGAAGGTATTCCTCTGCATAAGCCAGGGCA
AGAACATCTTCATACCTGGAGGAGGGCAAGGAGATCTTGGTAGGGCATGTGGGCCAGACT
ATAGACCACCCCTCTGCCACCTTTGTCAGGATGCTACCAGACAAGGACTGCTGGTATGCC
TCTGTGACACAACCTGTGAGAACAAAGAGAGCAAGAAGGAGGACCTAATGTTTATTTTCT
GGGCACCTAAGTCTGTACCCCTGAGAGCAAAATGATCTATGCCAGCTCGATGGACGCCAT
CATGAAGAAGCTGATGGAGACCAAGCATGAATTATAAGCAAACTGCTGTGAGGATGTCAT
GGACTGATGTACCTTGGCTGAGAAGTTGGGGGGCAATGCCATTATTTCCCTGGAAGGCAA
GCCTTTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SSTPEEVK-KRKKAVLFCLSEDKKNII-LEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYA-LYDATYETKESKKEDLVFIFWAPESAPLK-SKMIYA
SSTPEEV..K.KK.V..C.S..K...I.LEEGKEILVG.VGQT.D.P.ATFV.MLPDKDC.YA.L.D.T.E.KESKKEDL.FIFWAP.S.PL..SKMIYA
Retrocopy
SSTPEEVR/KCKK-VFLCISQGKNIFI\LEEGKEILVGHVGQTIDHPSATFVRMLPDKDCWYA/LCDTTCENKESKKEDLMFIFWAPKSVPLR/SKMIYA


Parental protein
SSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSTVISLEGKPL
SS.DAI.KKL...KHEL.ANC.E.V.D.CTLAEKLGG...ISLEGKPL
Retrocopy
SSMDAIMKKLMETKHEL*ANCCEDVMD*CTLAEKLGGNAIISLEGKPL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide