RetrogeneDB ID:
retro_mputfur_1486
Organism:
Location:
GL897164.1:628092-628400 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.15 %
Coverage:
85.83 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1486
ATGGCCCAGTTTGTTCGTAACCTGGCGGAGAAGGCCCCCGCGCTGGTGAACACTGCTGTG
ACTTACTCAAAGCCTCGATTGGCTACATTTTGGCACTATGCCAAAGTTGAGCTGGTTCCT
CCAACCCCTGCTGAGATCCCTACAGCTATTCAAGCTTGAAAAAAATAGTCAAGAGTGCTC
AAACTGGTAGCTTCAAACAGCTCACAGTTAAGGAAGCTCTGCTGAATGGTTTGGTGGCCA
CCGAGGTGTGGATGTGGTTTTATGTCCATGAGATCAGAGGCAAGCATGGCATCATTGGCT
ATAATGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAQFVRNLAEKAPALVNAAVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQ-SLKKIVKSAQTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKHGII
MAQFVRNLAEKAPALVN.AVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQ.SLKKIVKSAQTGSFKQLTVKEALLNGLVATEVWMWFYV.EI.GKHGII
Retrocopy
MAQFVRNLAEKAPALVNTAVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQ/SLKKIVKSAQTGSFKQLTVKEALLNGLVATEVWMWFYVHEIRGKHGII


Parental protein
GYNV
GYNV
Retrocopy
GYNV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide