RetrogeneDB ID:
retro_mputfur_1487
Organism:
Location:
GL897164.1:762486-763162 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.81 %
Coverage:
50.9 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
PSMC3
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) 26S subunit, ATPase, 3 [Source:HGNC Symbol;Acc:9549]

Genomic region (view in browser)





>retro_mputfur_1487
TTGGGGATCCAGCCTCCAAAAGGGGTGTTGATGTATGGCCCCCCAGGTACCGGGAAGACC
CTGCTGGCCCCGGGCCTGTGCTGCACAGACCAAGGCTACATTCCTGAAGTTGGCTGGCCC
CCAGCTGGTGCAGATGTTCATTGGGGATGGTGCCAAGCTGGTCTGGGATGCCTTTGCCCT
GGCCAAGGAGAAAGCTCCGTCCATTATCTTCATCGATGAGCTGGATGCCATCGGCACTAA
GCGCTTTGACAGTGAGAAGGCTGGAGACCAGGAGGTGCAGAGGAAGATGTTGGAACTTCT
GAACCAGCTGGATGGGTTCCAACCCAACACTCAAGTAAAGGTGATTGCAGCCACCAACAG
GGTGGATATCCTGGACCCCTCACTGCTCCGCTCAGGCCGTCTGGACCGGAAGATTGAATT
CCTGATGCCCAATGAGGAGGCCTGGGCCAGAATCATGCAGATCCACTCCCACAAGATGAA
CGTCAGTCCCGATGTGAACTATGAGGAACTGGCCCGCTGTATGGATGACTTCAATGGTGC
CCAGTGCAAGGCCGTGTGCATGGAGGTGGGCATGATCGCACTGCGCAGGGGCGCCACGGA
ACTCACGCATGAGGACTACATGAAGGGCATCCTGGAGGTGCAGGCCAAGAAGAAAGCCAA
TCTGCAGTACTATGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LGIQPPKGVLMYGPPGTGKTLLA-RACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLEL
LGIQPPKGVLMYGPPGTGKTLLA.RACAAQTKATFLKLAGPQLVQMFIGDGAKLV.DAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGD.EVQR.MLEL
Retrocopy
LGIQPPKGVLMYGPPGTGKTLLA\RACAAQTKATFLKLAGPQLVQMFIGDGAKLVWDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDQEVQRKMLEL


Parental protein
LNQLDGFQPNTQAQVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGAT
LNQLDGFQPNTQ..VIAATNRVDILDP.LLRSGRLDRKIEF.MPNEEA.ARIMQIHS.KMNVSPDVNYEELARC.DDFNGAQCKAVC.E.GMIALRRGAT
Retrocopy
LNQLDGFQPNTQVKVIAATNRVDILDPSLLRSGRLDRKIEFLMPNEEAWARIMQIHSHKMNVSPDVNYEELARCMDDFNGAQCKAVCMEVGMIALRRGAT


Parental protein
ELTHEDYMEGILEVQAKKKANLQYYA
ELTHEDYM.GILEVQAKKKANLQYYA
Retrocopy
ELTHEDYMKGILEVQAKKKANLQYYA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide