RetrogeneDB ID:
retro_mputfur_1489
Organism:
Location:
GL897167.1:907469-908327 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
94.46 %
Coverage:
99.65 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1489
ATGGCGGGCGAAAAAGCTGAGAAGCCGGATACTAAGGAGAAGAAACCTGAAGCCAAGAAG
GCTGATGGTGGTGGCAAGGCTAAGAAGGGTAACCAGAAGGCTAAAACCCCGAAGAAGGGG
AAGCCCCACTGCAGCCGAAACCCTGTCCTAGTCAGAGGAATTGGCAGGTACTCCCGATTG
GCTATGTATTCCAGAAAGGCCATGTACAAGAAGAAGTATTCGGCAGCTAAATCCAGGGTT
GAAAAGAAAAAGGAGAAGGTTCTTGCTACCGTCACAAAACCAGTTGGTGGTGACAAGAAC
GGTGGTACCCGAGTGGTTAAACTGTGCAAAATGCCTAGGTATTATCCTACTGAAGACGTG
CCTGGAAAGCTGTTGAGCCACGGCAAAAAACCTTTCAGTCAGCATGTGAGAAAATTGCAA
GCTAGCATCACCCCTGGGACCATTTGATCATCCTCACTGGGCGCCACAGAGGCAAGAGGG
TAGTTTTCCTGAAGCAGCTGAGCAGTGGCTTGCTACTTGTGACTAGACCTCTGTCCCTCA
ATCGAGTTCCTCTGTGTAGAACACACCAGAAATTCGTCATTGCCACTTCTACCAAAATTG
ATATCAGCAGCGTGAAAATCCCCAAACATCTCACTGATGCTTATTTTCAAGAAGAAGAAG
TTGCGTAAGCCCAGACACCAGGAGGGTGAGATCTTCGACACCGAGAAAGAGAAATATGAG
ATTACAGAGCAGCGCAAGGTTGATCAGAAAGCTGTGGTCTCACAAATTCTGCCAAAAATC
AAGGCTGTTCCTCAGCTTCAGGGCTATCTCCACTCTGTGTTTTCTCTCACAAATGGAGTT
TACCCTTACAAATTGGTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAGEKAEKPDTKEKKPEAKKTDGGGKAKKGNKKAKTPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAAKSRVEKKKKEKVLATVTKPVGGDK
MAGEKAEKPDTKEKKPEAKK.DGGGKAKKGN.KAKTPKKGKPHCSRNPVLVRGIGRYSR.AMYSRKAMYK.KYSAAKSRVE.KKKEKVLATVTKPVGGDK
Retrocopy
MAGEKAEKPDTKEKKPEAKKADGGGKAKKGNQKAKTPKKGKPHCSRNPVLVRGIGRYSRLAMYSRKAMYKKKYSAAKSRVE-KKKEKVLATVTKPVGGDK


Parental protein
NGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTI-LIILTGRHRGKRVVFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATST
NGGTRVVKL.KMPRYYPTEDVP.KLLSHGKKPFSQHVRKL.ASITPGTI.LIILTGRHRGKRVVFLKQLSSGLLLVT.PLSLNRVPL.RTHQKFVIATST
Retrocopy
NGGTRVVKLCKMPRYYPTEDVPGKLLSHGKKPFSQHVRKLQASITPGTI/LIILTGRHRGKRVVFLKQLSSGLLLVTRPLSLNRVPLCRTHQKFVIATST


Parental protein
KIDISNVKIPKHLTDAY-FKKKKLRKPRHQEGEIFDTEKEKYEITEQRKVDQKAVDSQILPKIKAVPQLQGYLRSVFSLTNGVYPHKLV
KIDIS.VKIPKHLTDAY.FKKKKLRKPRHQEGEIFDTEKEKYEITEQRKVDQKAV.SQILPKIKAVPQLQGYL.SVFSLTNGVYP.KLV
Retrocopy
KIDISSVKIPKHLTDAY\FKKKKLRKPRHQEGEIFDTEKEKYEITEQRKVDQKAVVSQILPKIKAVPQLQGYLHSVFSLTNGVYPYKLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide