RetrogeneDB ID:
retro_mputfur_1490
Organism:
Location:
GL897167.1:1200744-1201077 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
50.89 %
Coverage:
81.75 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
CST11
Parental gene aliases:
No gene alias available
Parental gene description:
cystatin 11 [Source:HGNC Symbol;Acc:15959]

Genomic region (view in browser)





>retro_mputfur_1490
TATCAAGCAAAGAAGAAAACCTATATGAGTGTCAAAGAAATGTTTGCAACAGGGATCAAT
GTGACTATCATGATGTTATTTGTGATCAACAAGTTCAACAAAGAAAGTAATAACAAGTAC
AACTTCCATATGGTCCAAGTCTTGGATCTACAGAAGCAGACAGCTGATTATATGTAATAT
TACATTTATACTGAGATATAATGGTCCACCTTTCAAAAGCTGGAGACTACTAACTGTGTC
TTTCACGAAGGATAACTTTACAAGAAAATCAAGTGCTATTTTTCAGTGTTATCTTGGCTT
GAAAAGTACAAAATTCTGAACAAAAACTGCACT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YQEKRKTFLSVKEVPASECYVAATMQYVINDFNEKSDDKYSFQTVHVLKVQKQITGHVLYHVNMEMRQTTCQKFETTNCSFQEGEIYKQIECFHSVFVPW
YQ.K.KT..SVKE..A....V...M..VIN.FN..S..KY.F..V.VL..QKQ......Y....E....T.QK.ETTNC.F.EG..YK.I.C..SV...W
Retrocopy
YQAKKKTYMSVKEMFATGINVTIMMLFVINKFNKESNNKYNFHMVQVLDLQKQTADYM*YYIYTEI*WSTFQKLETTNCVFHEG*LYKKIKCYFSV-LSW


Parental protein
FEKYRILNKNCT
.EKY.ILNKNCT
Retrocopy
LEKYKILNKNCT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide