RetrogeneDB ID:
retro_mputfur_1491
Organism:
Location:
GL897168.1:1201890-1202493 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.71 %
Coverage:
99.04 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
GAR1
Parental gene aliases:
No gene alias available
Parental gene description:
GAR1 ribonucleoprotein homolog (yeast) [Source:HGNC Symbol;Acc:14264]

Genomic region (view in browser)





>retro_mputfur_1491
TTTTGAGGCGGAGGTCAGTGGAGGCTTTGATCAACGTGGCAGCTTCATTTGTGACCACAG
CAACTACCATTTCCGAGATGGAGGTGGTAATTTCAGAGGCAATGGTGGCCACAGAGGAGG
ATTTTGACAAGGAGGTGGCCACAGAGGCTTTAACAGAGACCAAGACCAAGGACCTCCAGA
ACATGTAGCTGTATTAGGGGAGTTCCTGTATCCCTGTGAAGATGACCTAGTTTATAAATG
TACTACAGGCAAAAACGCCAATGCTGCAGTTTATTTAGAGAACAAAGAACAAATTAGCAA
AGTGAGCGAAATATTTGGACAACTTAGAGATGTTTGTTTTTCCATTAAATTGTCAGCAAA
TATGAAGGTATTTTCCTTTAAAAAACTGCAGAAGTCTTATATAGACCCATAGAAACTGCT
ACCATCACAGAGGTTTTTACCTCGACCTCCAGGTGGGAAGTGACCTCCAAGAGAAGGTGG
CAGGAGGAGGGGGAGGAGGTGGCTGAGGTGACAGAGGTGATGGCTTTAGAGGTAGAAAGA
GAAGATCGAAGTGGAGGTTTCAGAGGAGGAAGTGGAGGTGGTGGTTTCAGAGGGAAACGA
CAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FRGGGR-GGFNRGGGFNRGGSNNHFRGGGGNFRGGGGGRGGFGRGGGRGGFNKGQDQGPPEHVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENK
F.GGG..GGF...G.F....SN.HFR.GGGNFRG.GG.RGGF..GGG..GFN..QDQGPPEHV..LGEFL.PCEDD.V.KCTT..N.....NA.VYLENK
Retrocopy
F*GGGQ\GGFDQRGSFICDHSNYHFRDGGGNFRGNGGHRGGF*QGGGHRGFNRDQDQGPPEHVAVLGEFLYPCEDDLVYKCTTGKNA----NAAVYLENK


Parental protein
EQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGR-GGRGGGRGGGGRGGRGGGFRG-GRGGGGFRGGR
EQI.KV.EIFGQLRD..FS.KLS.NMK..SFKKLQK.YIDP.KLLP.QRFLPRPPG.K.PPR.GGR.GG.GGG.G..G.G.RG...R....G..G..GG.
Retrocopy
EQISKVSEIFGQLRDVCFSIKLSANMKVFSFKKLQKSYIDP*KLLPSQRFLPRPPGGK*PPREGGR\GGGGGG*GDRGDGFRGRKRRS\SGGFRGGSGGG


Parental protein
GGGGFRGRGH
G...FRG..H
Retrocopy
G---FRGKRH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide