RetrogeneDB ID:
retro_mputfur_1493
Organism:
Location:
GL897170.1:98116-98452 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.86 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
FAM32A
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 32, member A [Source:HGNC Symbol;Acc:24563]

Genomic region (view in browser)





>retro_mputfur_1493
ATCGCGGCCTACGAGCAAGTTCAAAAGGGGCCCCTGAAACGAAAAGGCGTTGCAGAGCTT
GGCGTCACCAAGCGAAAGGAGAAAAAGAAGGACAAAGACAAGGCAAAACTCCCGGAAGCG
ATGGGAACGAGCAAAAAGAATGAGGAGGAGAAGAGGCGCGGCCTGGACAAGCGAACCCCG
GCCCAGGCGGCCTTCGAGAAGATGCAAGAGAAGCGGCAAATGGAGAGGATCCTAAAGAAA
GCATCCAAAACCCACAAGCAGAGAGTGGAGGACGTCAACAGACACCTGGCCACCCTCACG
GGGCACTACGACATTCCCAAAGCCAGCTGGACGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLT
.AAYEQVQKGPLK.KGVAELGVTKRK.KKKDKDKAKL.EAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVED.NRHL.TLT
Retrocopy
IAAYEQVQKGPLKRKGVAELGVTKRKEKKKDKDKAKLPEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDVNRHLATLT


Parental protein
EHYDIPKVSWTK
.HYDIPK.SWTK
Retrocopy
GHYDIPKASWTK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide