RetrogeneDB ID:
retro_mputfur_1494
Organism:
Location:
GL897170.1:211813-212788 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
93.9 %
Coverage:
94.22 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
XBP1
Parental gene aliases:
No gene alias available
Parental gene description:
X-box binding protein 1 [Source:HGNC Symbol;Acc:12801]

Genomic region (view in browser)





>retro_mputfur_1494
GGCAAGCGGGAGTCCGCCCCAGGCACGCGCCTCACGCGCCTGAGCCCCGAGGAGAAGGCG
CTGCGGAGGAAACTGAAAAACAGAGTAGCAGCCCAGACTGCCAGAGACCGAAAGAAAGCT
CGAATGAGTGAGCTGGAACAGCAAGTGGCAGATTTGGAGGAAGGGAACCAAAAACTTTTG
CTAGAAAATCAACTTTTGCGAGAGAAAACTCATGGCCTGTAGTTGAGAACCAGGAGTTAA
GACAGCGCTTGGGGATGGATGCCCTGGTTACTGAAGAGGAGGTGGAGACCCAGACCAAGG
GGAATGGAGCGAGGCCAGTGGCCGGGTCTGCTGAGTCCGCAGCAGGTGCAGGCCCAGTTG
TCACCCCTCCAGAACATCTCCCCATGGATTCTGACAGCGTTGACTCTTCAGACTCAGAGT
CTGATATCCTGTTGGGCATTCTGTTCAACTTGGATCCAGTCATGTTCTTCAGATGTCCTT
CCCCAGAGTCTCCCAGCCTGGAGCAGCATCCAGAAGCCCATCCAGAAGGACCCAGTTCCT
TACCAGCCTCCCCTTCTCCGTCACTGGGGACGTCATCAGCCAAGCTGGAAGCCATTAATG
AACTGATTTGTTTTGATTAAGTATACACCAAGCCCCTAGTCTTAGAGATACCCTCTGAGA
CAGAGAGCCAAGCTAATGTGGTAGTGGAAATTGAGGAAGCACCTTTCAGCCCCTCAGAGA
AAGATCACCCTGAATTCACTGTCTCAGTGAAGGAAGAACTTGGTAGAAGATGACTTCATT
CCAGAGCTGGGCACCTCAGATCTTCTTTCATCCAGCCACTGCCTCAAGTCATCTTCCTGT
CTACTGGATGCTTACAGTGACTGTGGCTATGAGGGCTCCCCTTCTCCCTTGAGCGACATG
TCCTCTCTGCTTGGTGTAGACCATTCTTGGGAGGACACTTTTGCTAATGAACTCTTTCCT
CAGCTGATTAGTGTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GPPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGL-VVENQELRQRLGMDALVTEEEVETQT
G........RLT.LSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQV.DLEE.NQKLLLENQLLREKTHGL.VVENQELRQRLGMDALVTEEEVETQT
Retrocopy
GKRESAPGTRLTRLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVADLEEGNQKLLLENQLLREKTHGL/VVENQELRQRLGMDALVTEEEVETQT


Parental protein
KGNGARPVAGSAESAAPGAGPVVTPPEHLPMDSDSVDSSDSESDILLGILFNLDPVMFFRCPSPESPSLEQHPEAHPEGPSSLPASPSPSLGTSSAKLEA
KGNGARPVAGSAESAA.GAGPVVTPPEHLPMDSDSVDSSDSESDILLGILFNLDPVMFFRCPSPESPSLEQHPEAHPEGPSSLPASPSPSLGTSSAKLEA
Retrocopy
KGNGARPVAGSAESAA-GAGPVVTPPEHLPMDSDSVDSSDSESDILLGILFNLDPVMFFRCPSPESPSLEQHPEAHPEGPSSLPASPSPSLGTSSAKLEA


Parental protein
INELIRFDHVYTKPLVLEIPSETESQANVVVKIEEAPFSPSEKDHSEFTVSVKEE-LVEDDFIPELGTSDLLSSSHCLKPSSCLLDAYSDCGYEGSPSPL
INELI.FD.VYTKPLVLEIPSETESQANVVV.IEEAPFSPSEKDH.EFTVSVKEE.LVEDDFIPELGTSDLLSSSHCLK.SSCLLDAYSDCGYEGSPSPL
Retrocopy
INELICFD*VYTKPLVLEIPSETESQANVVVEIEEAPFSPSEKDHPEFTVSVKEE\LVEDDFIPELGTSDLLSSSHCLKSSSCLLDAYSDCGYEGSPSPL


Parental protein
SDMSSLLGVDHSWEETFANELFPQLISV
SDMSSLLGVDHSWE.TFANELFPQLISV
Retrocopy
SDMSSLLGVDHSWEDTFANELFPQLISV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide