RetrogeneDB ID:
retro_mputfur_1499
Organism:
Location:
GL897178.1:847872-849097 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
91.57 %
Coverage:
99.76 %
Frameshifts:
5
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:UniProtKB/TrEMBL;Acc:G9KQ49]

Genomic region (view in browser)





>retro_mputfur_1499
TCAAAAAGACCATCTTATGCCCCACCCCCCACCGCAGCTCCTGCAACACAAATGCCCAGC
ACACCAGGGTTTGTGGGTTACAATCCATACCATCACCTCGCCTACAACAACTACAGGCTG
GGGGGAAACCACGCACCAACAGCCGGGTCACGGCATCCTTTGGTATTACGATTCCAAAAC
CCCCAAAGCCACCAGATAAGCTGCTAATGCCCTACATGAGGTCAGCAGAAAGGTCTGGGA
CCAAGCAAAAGCTTCCAACCCTGACCTAAAGTTGTGGGAGACTGGCAAGATTATTGGTGG
CATGTGGCAAAATCTCACTGATGAAGAAAAATAAGAATATTTAAATGAATACAAAGCAGA
AAAGATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCATACCTTGCTTA
CATAAATGCAAAAAGTCTTGCAGAAGCTGCTTTAGAAGAAGAAAGTCGACAGAGACAGTC
TCGCATGGAGAAAGCAGAACCGTACATGAGCATCCAGCCTGCTGAAGATCCAGACGATTA
TGATAATGGCTTTTCAATGAAGCATACAGCCACCGCCCGTTTCCAGAGAAACCACCGCCT
CATCAGTGAAATCCTCAGTGAGAGTGTGGTGCCGGATGTTCGGTCAGTTGTCACAACAGC
TAGAATGCAGGTCCTCAAAGGACAGGTCCAGTCCTTAATGTTTCATCAGCGAAAACTAGA
AGCTGAACTTCTTCAAATAGAGGAGGGACACCGGGAAAAGAAGAGGAAATTCCTGGAAAG
CACAGATTCATTTAACAATGAACTTAAAAGGCTGTGCGGTTTAAAAGTAGAAGTGATATG
GAAAAAATTGCTGCTGAATTGCACAGGCAGAGGAGCAGGCTCGAAAAAGGCAGGAGGAAA
GAGAGAAAGGGGCAGCAGAGAAGGCTGAATGCAGTCAGAGCAGCATGGTTGCTGAGGAGG
AGCAGGCTGCGAGTAAGACCGAAGAGAAGAAGGAGGACGAGAGCATCCCGACGGAGACAA
GGAGACACACCTTGAAGAAGCGACGGAAAGCCAACAAAATGGTGAAGAAGGCACATCTAC
TCCTGAGGACAAGGAGAGCGGGCAGGAGGGGGTGGACAGTATGGCTGAGGAAGGGACCAG
TGATAGTAACACTGGCTCGGAGAGCAACAGTGCCACGGTGGAGGAGCTGCCAACAGACCC
CGCCCTGGAAGACGAGAAGAAAGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TERPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGN-PGTNSRVTASSGITIPKPPKPPDKPLMPYMR-YSRKVWDQVKASNPDLKLWEIGKI
..RPSYAPPPT.APATQMPSTPGFVGYNPY.HLAYNNYRLGGN.P.TNSRVTAS.GITIPKPPKPPDK.LMPYMR..SRKVWDQ.KASNPDLKLWE.GKI
Retrocopy
SKRPSYAPPPTAAPATQMPSTPGFVGYNPYHHLAYNNYRLGGN/PRTNSRVTASFGITIPKPPKPPDKLLMPYMR/VSRKVWDQAKASNPDLKLWETGKI


Parental protein
IGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSHAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRN
IGGMW..LTDEEK.EYLNEY.AEKIEYNESMKAYHNSPAYLAYINAKS.AEAALEEESRQRQSRMEK.EPYMSIQPAEDPDDYD.GFSMKHTATARFQRN
Retrocopy
IGGMWQNLTDEEK*EYLNEYKAEKIEYNESMKAYHNSPAYLAYINAKSLAEAALEEESRQRQSRMEKAEPYMSIQPAEDPDDYDNGFSMKHTATARFQRN


Parental protein
HRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEV-DMEKIAAE-IAQAEEQAR
HRLISEILSESVVPDVRSVVTTARMQVLK.QVQSLM.HQRKLEAELLQIEE.H.EKKRKFLESTDSFNNELKRLCGLKVEV.DMEKIAAE.IAQAEEQAR
Retrocopy
HRLISEILSESVVPDVRSVVTTARMQVLKGQVQSLMFHQRKLEAELLQIEEGHREKKRKFLESTDSFNNELKRLCGLKVEV/DMEKIAAE/IAQAEEQAR


Parental protein
KRQEEREKEAAEQAERSQSSMVAEEERAASKTEEKKDDESVPTET-EETHLEEATESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATV
KRQEEREK.AAE.AE.SQSSMVAEEE.AASKTEEKK.DES.PTET..ETHLEEATESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATV
Retrocopy
KRQEEREKGAAEKAECSQSSMVAEEEQAASKTEEKKEDESIPTET/KETHLEEATESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATV


Parental protein
EEPPTDPAPEDEKKE
EE.PTDPA.EDEKKE
Retrocopy
EELPTDPALEDEKKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide