RetrogeneDB ID:
retro_mputfur_1501
Organism:
Location:
GL897182.1:1149824-1150160 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
59.83 %
Coverage:
93.44 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_1501
TTCAGAATGCTCCAGCATTTGACATACTGTCATAGGCTGTCCTACAATACAGCCTCTAAC
AAAGCTAAGCTGCCCAAACCCCTGGTATCAGAATTGTTTACCTTTATACCAAGAAGGTTT
GGAGGCACCAAAATCCTCATGACACATCTGCACAGACTCACTTTGAGGAGTTACTGCTAT
GAGATCTGAACTTTTAATGAAGTTGTCTAAAGTGAAAAAACATGTCGGCAGGACATATGG
GGGTTCTATGTTGCTTAGAGTGTCCAGGACAGGATCAAGCTTGCTTTCCTTGTTGAGGAA
ACACTTCCTTGTGAAGTGTTAAAGACACAGAGAGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FRMVQRLTYRRRLSYNTASNKTRL-SRTPGNRIVYLYTKKVGK-APKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAK-CVRDRIKRAF
FRM.Q.LTY..RLSYNTASNK..L...TPG.RIVYLYTKKV...APKS....C...L.GV.A.R...LM.LSK.KKHV.R.YGGSM.....V.DRIK.AF
Retrocopy
FRMLQHLTYCHRLSYNTASNKAKL/AQTPGIRIVYLYTKKVWR/APKSS*HICTDSL*GVTAMRSELLMKLSKVKKHVGRTYGGSMLLR/SVQDRIKLAF


Parental protein
LIEEQKIVVKVLKAQAQ
L.EE......VLK.Q..
Retrocopy
LVEE-TLPCEVLKTQRE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide