RetrogeneDB ID:
retro_mputfur_1508
Organism:
Location:
GL897187.1:989040-989572 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.38 %
Coverage:
80.27 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
Chmp3
Parental gene aliases:
No gene alias available
Parental gene description:
charged multivesicular body protein 3 [Source:MGI Symbol;Acc:MGI:1913950]

Genomic region (view in browser)





>retro_mputfur_1508
AAACAATCTGTGAAAGATGCTGCCAAGAAGGGCCAGAAGGATGTCTACATGGTTCCAGCT
AATGAGATGATAGGTCAAGGAAGGTCATGAGCACTCTTTATGCATCCAAAGCTCACATGA
ACTCTGTGCTCATGGGGACAAAGAACCAGCTGGTGGTCTGAAAATGGCTGGTTCCTTCCC
TGCAAAAGAACACAGAAGTGATGAAGGCCACTCAGAGTCTTGGAAAGACCCCATCAACCC
AGGGCACCATATAGGAATTGTCCAAAGAGATTTCAAAGACTGAGATCATGGAAGAGGTGG
TAGAGGATACTTTTGAAAGCATAAATGTTCTGGAAGAAATGGAAGAAGGAGCAGAAGTGG
AATTGATAAAGTTTTCTTTGAAATTACAGCAGGAGCCTTTGGCAAAGCACCTCACAATGA
GCCTCGTATACTTCTAGAGACCAAATCTCCAGGAGGAGTAGCTGCCTTAGAAGATAAGGA
GTAGGAAGAAGCTTTGGAGGCCATGCAATCCTAGCTGGCCATGCTCCACAGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KRSVKDAAKKGQKDVCVVLAKEMI-RSRKAVSKLYASKAHMNSVLMGMKNQLAVLR-VAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEE
K.SVKDAAKKGQKDV..V.A.EMI.RSRK..S.LYASKAHMNSVLMG.KNQL.V......SLQK.TEVMKA.QSL.K.P..Q.T..ELSKE..K..I.EE
Retrocopy
KQSVKDAAKKGQKDVYMVPANEMI/RSRKVMSTLYASKAHMNSVLMGTKNQLVV*KWLVPSLQKNTEVMKATQSLGKTPSTQGTI*ELSKEISKTEIMEE


Parental protein
MLEDTFESMDDQEEMEEAAEME-IDKILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEEALEAMQSRLATLRS
..EDTFES....EEMEE.AE.E.IDK..FEITAGA.GKAP......L.E...PG..AA.ED...E.EEALEAMQS.LA.L.S
Retrocopy
VVEDTFESINVLEEMEEGAEVE/IDKVFFEITAGAFGKAPHNEPRILLETKSPGGVAALED--KE*EEALEAMQS*LAMLHS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide