RetrogeneDB ID:
retro_mputfur_1509
Organism:
Location:
GL897188.1:418743-419381 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
89.86 %
Coverage:
61.19 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
DDI2
Parental gene aliases:
No gene alias available
Parental gene description:
DNA-damage inducible 1 homolog 2 (S. cerevisiae) [Source:HGNC Symbol;Acc:24578]

Genomic region (view in browser)





>retro_mputfur_1509
ATTGTCTATGCTGAAAGACCTCTCACATACAACCACAGATTGCTGGCTTCCTAGGGCTTG
AAAGATGGGGATGTTGTGATTTTAGGACAGAAGGAGAACGCCGACCCTTGACCTCCAGTG
CAGTTCCCAAACTTACCCCGCATAGACTTCCTAGTATAGCCGTACCTGGCACATCAGGCT
CCTGGCAGCGCCAGCCACCAGCACAGCATTCCCACTCATCTCCTGGAGACATAGCTTCAT
CTCCTCAGGGCTTGGCCTTGCTCCGAGACATGTTGCTGGCCAACCCCCATGAGCTGTCCT
TGCTGAAGGAACACAACCCGCCCTTGGCAGATGCTCTGTTCAGTGGAAACCTTGAGAAAT
TTTCTAGGGTCCTGGTGGAGCAGCAGCAGGACAGAGCCCAGAGAGAGCAAGAAAGGATTC
ATTTCTTTTCTGTTGACCCTTTTGATTTTGAAGCTCAGGCAAAAATAGAAGAAGATATAA
GGCAACAGAACATTGAGGAAAACATGACGATAGCTATGGAAGAAGCCTCTGAAAGTTTTG
GCCAAGTAGTGATGCTTTATATTAACTGCAAAGTAAATGAACACCCTGTGAAAGCCTTCA
CTGACTCAGGTGCCCAGATGACTATTATGAGCCAAGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IVYAERPLTDNHRSLASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFR-SIAVPGTSGSRQRQPPAQHSHSSPGDIASSPQGLDNPALLRDMLLANP
IVYAERPLT.NHR.LAS.GLKDGDVVIL.QKENADP.PPVQFPNLPRIDF..SIAVPGTSGS.QRQPPAQHSHSSPGDIASSPQGL...ALLRDMLLANP
Retrocopy
IVYAERPLTYNHRLLAS*GLKDGDVVILGQKENADP*PPVQFPNLPRIDFL/SIAVPGTSGSWQRQPPAQHSHSSPGDIASSPQGL---ALLRDMLLANP


Parental protein
HELSLLKERNPPLADALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHP
HELSLLKE.NPPLADAL.SG.LEKFSRVLVEQQQDRA.REQERI..FS.DPFD.EAQAKIEEDIRQQNIEENMTIAMEEA.ESFGQVVMLYINCKVN.HP
Retrocopy
HELSLLKEHNPPLADALFSGNLEKFSRVLVEQQQDRAQREQERIHFFSVDPFDFEAQAKIEEDIRQQNIEENMTIAMEEASESFGQVVMLYINCKVNEHP


Parental protein
VKAFVDSGAQMTIMSQA
VKAF.DSGAQMTIMSQA
Retrocopy
VKAFTDSGAQMTIMSQA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide