RetrogeneDB ID:
retro_mputfur_1510
Organism:
Location:
GL897190.1:1357691-1358336 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.01 %
Coverage:
52.8 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
SERPINE2
Parental gene aliases:
No gene alias available
Parental gene description:
serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 [Source:HGNC Symbol;Acc:8951]

Genomic region (view in browser)





>retro_mputfur_1510
GTTAAAAATGAAGCTGGTGATATGATGGCCAGTCTCCTTTCCCTAGACCATATCAATGAT
ATGTTCATTGAACTGTGTGTTGTTGATGAGATGTAATTTAAGGTTTAAGAAAATCAAGGT
TTCAATCTGAGAATACAAAGAAAGTTCATTTTGGGGAAGTGATGGGGAATCTTATCAGTG
GCAGTAGTAGTCCAGCTCTCTCTGTTCTGCTGGGGATCAAAAGTACCCCAGTGATTTATG
GTACAACTTCATTGAACTACCATATCATGGGGAAAACATCAGTAGTCTGACCATTCTGCC
AGTCAAGACCTCACCCTCATCCTCAGCCATTACTTCCACATCAGCACCAATACCATAGAC
AACTGATGTGAGCACCATGGCATCAAGAGTATGCAGCTAATTCTGCCCAAGTGCACAGCC
ATAGCATAAACTGATTTGAAGGAGCCACTGAAAGTTGTTGGTGTTGCCAAGATGCTTGAT
CCATCAAAAGCAAATTCTGCAAAAATAACAAGGTCAGAAAACCTACATGTTTCTTACATC
TTGCAAAAAGCAAACCTTCAAGTCAGCAAAGATGGAACCAAAGCTTCAGCAACAACAACT
GGGAATCTAATCACAAGGTCATTACTTCCTTTGTTCATTGTAGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VKNETRGMIDSLLSPDLIDGALTRLVLVNAVYFK-GLWKSRFQPENTKK-RTFVAADGKSYQ-VPMLAQLSVFRC-GSTSTPNDLWYNFIELPYHGESIS
VKNE...M..SLLS.D.I......L..V....FK.GL.KSRFQ.ENTKK...F...DG.SYQ.V....QLS.F.C.G....P.DLWYNFIELPYHGE.IS
Retrocopy
VKNEAGDMMASLLSLDHINDMFIELCVVDEM*FK/GLRKSRFQSENTKK/SSFWGSDGESYQ/VAVVVQLSLF-C\GDQKYPSDLWYNFIELPYHGENIS


Parental protein
MLIALPTESSTPLSAIIP-HISTKTIDSWMSTMVPKRVQVILPKFTAVAQTDLKEPLKALGITEMFEPLKANFAKITRSENLHVSHILQKAKIEVSEDGT
.L..LP...S...SAI...HIST.TID........K..Q.ILPK.TA.A.TDLKEPLK..G...M..P.KAN.AKITRSENLHVS.ILQKA...VS.DGT
Retrocopy
SLTILPVKTSPSSSAITS/HISTNTIDN*CEHHGIKSMQLILPKCTAIA*TDLKEPLKVVGVAKMLDPSKANSAKITRSENLHVSYILQKANLQVSKDGT


Parental protein
KASAATTAILIARSSPPWFIVD
KASA.TT..LI.RS..P.FIVD
Retrocopy
KASATTTGNLITRSLLPLFIVD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide