RetrogeneDB ID:
retro_mputfur_1511
Organism:
Location:
GL897191.1:540776-541311 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.74 %
Coverage:
79.2 %
Frameshifts:
3
Stop codons:
7


Parental gene:
Parental gene symbol:
CCDC43
Parental gene aliases:
No gene alias available
Parental gene description:
coiled-coil domain containing 43 [Source:HGNC Symbol;Acc:26472]

Genomic region (view in browser)





>retro_mputfur_1511
TTGGTGCAGGAGGAGGAGAAAAGAGAAGTCTGATGCTCTGCAGGGTATCCTCTCTGTCTT
CTTGGAAGAAGATTCTCTTCTTACCCTCTTCAAGGAAATTGTGGAACAATGGTCGTTGGA
AAGTTGGAATGTTCTCACCAAGGTGAACAAAGAAGATAAGATACAGGCCCTTGCCACCTA
AATTTAGAAGCAGGCAGACTGTGGTGAAGCCCAGGATGGTGTCAGAAGGGGAGAAGCAGA
TAAAGCTGCACTTGTAGCCCAGTCAGTATACTGCTGTGACAGATGCAGAAGACGAGAAGG
ATGAGAAGGATGATTCAGACACCGCCACTAAGAATCTTGGTTCTGATATGTCTTTATTCT
GAAACGCCAATGTGGAAGATGTCCTCAATGCTGGAAAACTGGAGTGAGTGTCACTTTGGG
ATGAGTCCTGAAGGAAGAAAGAATAGGACAAGCTGCAGATGGAGAGGGACAAACTGGAAA
GCAGGAACGCAAGGAAAGGAAAGAGAAAAGGGCACAATGAGGGGAGTGGAAGCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LQEEEEE-ERLDALQGILSAFLEEDSLLNICKEIVERWS-ESQNVVTKVKKEDEVQAIATLIEKQAQIVVKPRMVSEEEKQRKAALL-AQYADVTDEETL
L..EEE..E..DALQGILS.FLEEDSLL...KEIVE.WS.ES.NV.TKV.KED..QA.AT.I.KQA........V...E....A.....QY..VT.....
Retrocopy
LVQEEEK\EKSDALQGILSVFLEEDSLLTLFKEIVEQWSLESWNVLTKVNKEDKIQALAT*I*KQADCGEAQDGVRRGEADKAALVA\SQYTAVTXXXXX


Parental protein
TEADEKDDSCASTVNIGSDKSLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKL-AKQERKEKEKKRTQRGERKR
.......D........GSD.SLF.N.NVEDVLNA.KLE..SL.DES.RKKE.DKLQ.ERDKL..KQERKE...KR.Q.GE.K.
Retrocopy
XXXXXXSDTATKNL--GSDMSLF*NANVEDVLNAGKLE*VSLWDES*RKKE*DKLQMERDKL/GKQERKERKEKRAQ*GEWKQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide