RetrogeneDB ID:
retro_mputfur_1517
Organism:
Location:
GL897202.1:1150992-1151453 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.61 %
Coverage:
59.53 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL8
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L8 [Source:HGNC Symbol;Acc:10368]

Genomic region (view in browser)





>retro_mputfur_1517
CTGTGCACTGTGGACTTTGCAGAGTCGTCAAGCTACATCAAGGGCATCATGAAGAACATC
ATTCATGATCCAGGCTGGGGTGTGCCACTCACCAAGGTAGTTTTCTGAGATCCATACTGA
TTTAAGAAGTGGAGGGGGCTGTTCATGGTCACCAAGGTCATCCATACCAGCCAGTTCATT
TACTGTGGCAAGATGAACCAGCTCAACACAGGCAATGTACTCCTGGTGGGCAAATATGCC
TGATGGCATCATTATATGTTTCTGGAGGAGAAGACTGGTGACTGGAGTAAGTTGGCCTGA
GCCTCTGGAAGAAATACTGCTGTCATTTCTCACAACCCTAAGACCAAGAAGACCCACGTG
AAGCTGCCCTTTTGGTTCAAAGGAGGTTTATTCTTCAGCCAAGAGAAGCTATGGTTGGTG
TGGTGGCTGGAAGTGGTAGCACTGACAAGGCCATTCTGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVG-TMPEGTIVC-CLEEKPGDRGKL
L..VDFAE...YIKGI.K.IIHDPG.G.PL.KVVF.DPY.FKK...LF.....IHT.QF.YCGK..QLN.GNVL.VG..MP.G.I.C..LEEK.GD..KL
Retrocopy
LCTVDFAESSSYIKGIMKNIIHDPGWGVPLTKVVF*DPY*FKKWRGLFMVTKVIHTSQFIYCGKMNQLNTGNVLLVG\NMPDGIIIC/FLEEKTGDWSKL


Parental protein
ARASGNYATVISHNPETKKTRVKL-PSGSKKVISSANR-AVVGVVAGGGRIDKPILK
A.ASG....VISHNP.TKKT.VKL.P.GSK.V.SSA.R.A.VGVVAG.G..DK.ILK
Retrocopy
A*ASGRNTAVISHNPKTKKTHVKL\PFGSKEVYSSAKR\AMVGVVAGSGSTDKAILK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide