RetrogeneDB ID:
retro_mputfur_1518
Organism:
Location:
GL897202.1:1291384-1291810 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.03 %
Coverage:
61.57 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
OIP5
Parental gene aliases:
No gene alias available
Parental gene description:
Opa interacting protein 5 [Source:HGNC Symbol;Acc:20300]

Genomic region (view in browser)





>retro_mputfur_1518
ATGGCAGCTCTCCTGTGATGGCATTGCTCACACCAAGCAAAGCTGCAGTGGGGTGACTTT
TGTGATGGCTCTAAGAAGGCAACTGGAAAAATTTCTTGGACAGCTTCTATGGAGTGGGAC
ACACAGTGGGTGAGTGGGTTCTCACTGCTTGGCCCTACAGCCCTTGGGGGTGAGGAATCG
CCATCAGGCTCACAGAAAGGCAGTCTTTGCCTATAGCACAAGAGGTACACAGTGTGCCAA
TGTGCACAGTGCCACACTGTGCTCGCTGAATCTGTGCAACTAGTATGGGACTCTCACGGT
CCCTTAGGGCTGTGGTCTTCTCCAGAGTAACAAATAACCGGGTTTGGGAAGCTCCCTTCC
TAGCTGGCGTTGAAACTTTGTTCAAAGGTGGCCCTTAACAAGTTTTTATTCTGTACTTCC
TATGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAARPRRHRSRCAQLPGGDFCDAAKKTTDKHSCTTSMEWDTQVVNGSSPLGPANLGAEELPSGPRLPS-WLQPERCAVFQCAQCYAVLADSVHLAWD-LS
MAA....H.S..A.L..GDFCD..KK.T.K.S.T.SMEWDTQ.V.G.S.LGP..LG.EE.PSG....S..L...R..V.QCAQC..VLA.SV.L.WD.LS
Retrocopy
MAALL*WHCSHQAKLQWGDFCDGSKKATGKISWTASMEWDTQWVSGFSLLGPTALGGEESPSGSQKGSLCL*HKRYTVCQCAQCHTVLAESVQLVWD/LS


Parental protein
RSLGAVVFSRVTNNVVLEAPFLVGIDGSLKG-STYNLLFCTSCG
RSL.AVVFSRVTNN.V.EAPFL.G.....KG......LFCTS.G
Retrocopy
RSLRAVVFSRVTNNRVWEAPFLAGVETLFKG\ALNKFLFCTSYG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide