RetrogeneDB ID:
retro_mputfur_1519
Organism:
Location:
GL897202.1:506855-507050 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.38 %
Coverage:
61.32 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
BOLA3
Parental gene aliases:
No gene alias available
Parental gene description:
bolA homolog 3 (E. coli) [Source:HGNC Symbol;Acc:24415]

Genomic region (view in browser)





>retro_mputfur_1519
AGGTTTTCTGGAGCTACAACTACCAACGCCACTGACATTTCAGGAGGCTGTGGGGCGATG
TATGAAATCCAGATCAAGACAGAAGAGCTTAAGGAGAAGAAAACTGTCCAGCAGCCCCAG
ATGGTAAAGCAGGCACTGAAAGAAGAAATCAAAGGGATGCACGGATTGTGGATGTTTACC
TCCGTCCCCAAACAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KFPGATAIKVTDISGGCGAMYEIRIESEEFKEKRIVQQHQMVNQALKEEIKGMHGLRIFTSVPKH
.F.GAT....TDISGGCGAMYEI.I..EE.KEK..VQQ.QMV.QALKEEIKGMHGL..FTSVPKH
Retrocopy
RFSGATTTNATDISGGCGAMYEIQIKTEELKEKKTVQQPQMVKQALKEEIKGMHGLWMFTSVPKH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide