RetrogeneDB ID:
retro_mputfur_1521
Organism:
Location:
GL897205.1:329266-329584 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.82 %
Coverage:
61.71 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1521
TCTCAGCTTCCTCAGAATTACTTGACTTAGGTGAAGGCTGCCAACATGCCTGGTCAACAT
GCATCTGTGAGCCTCCTACACCTACCCTTTTCCAAGCTTCTATTCCCACCAGGATGATGT
GGCTCTGGATGGCACAGGCCACTTCTGTGAGCTGGCCAAGGAGAAGCACCAGGACACTAG
CGCTCCTAGAAGATGCAAAACCAGCTACCAGGTTGCACCCTCTTCCAGGAGGTGTAGAAG
CAGTCCCAAGATGAGTGGGGTAAAACCCTGTTCGCCATCGAAGTTGCAATAGTCTTAGAG
AAGAACCTGGAGCAGGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SQIRQNYSTEVEAAVNR-LVNMHLRASYTYLSLGFYFDRDDVALEGVGHFFRELAEEKRE-GAERLLKMQNQRGGRALFQDVQKPSQDEWGKTLDAMEAA
SQ..QNY.T.V..A.N..LVNMHL.ASYTY....FY...DDVAL.G.GHF..ELA.EK...G..R..KMQNQ..G..LFQ.V.K.SQDEWGKTL.A.E.A
Retrocopy
SQLPQNYLT*VK-AANM\LVNMHL*ASYTYPFPSFYSHQDDVALDGTGHFC-ELAKEKHQ/GH*RS*KMQNQLPGCTLFQEV*KQSQDEWGKTLFAIEVA


Parental protein
LVLEKSLNQA
.VLEK.L.QA
Retrocopy
IVLEKNLEQA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide