RetrogeneDB ID:
retro_mputfur_1525
Organism:
Location:
GL897208.1:200698-201168 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
90.57 %
Coverage:
76.7 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_1525
AAGATGAAAGAAACTATCATGAACCAGCAGAAACTCACCAAACTGCAAGCACAAGTGTGC
ATTGGTGGGAAAGGAACTGCTCGCCGAAAGAAGGTGGTTCATAGAACAGCTACAGCAGAT
GATAAAAACTCCAGTTCTCCTTAAAGAAGTTCGGGGTAAACAATATCTCTGGTATTGAAG
AAGTGAATATGTTCACAAACCAAGGACCAGTGATCCACTTTAACAACCCCGAAGTTCAGG
CATCGCTGGCAGCGAACACTTTCACCATTACAGGTGAAAGAAAGAAAAAGAAGCTGACAG
AAATGCTACCCAGTATCTTAAACCAACTTGGTGCAGACAGTCTGACTAGTTTAAGAAGAC
TGGCTGAAGCTCTGCCCAAACAATCTGTGGATGGAAAAGCACCACTTGCTACTGGAGAGG
ATGATGATGATGAAGTTCCAGATCTTGTGGAGAATTTTGATGAAGCAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDK-KLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQ
.MKETIMNQ.KL.KLQAQV.IGGKGTARRKK.VVHRTATADDK.KLQFSLKK.GVNNISGIEEVNMFTNQG.VIHFNNP.VQASLAANTFTITG....K.
Retrocopy
KMKETIMNQQKLTKLQAQVCIGGKGTARRKK-VVHRTATADDK/KLQFSLKKFGVNNISGIEEVNMFTNQGPVIHFNNPEVQASLAANTFTITGERKKKK


Parental protein
LTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEAS
LTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEA.
Retrocopy
LTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide