RetrogeneDB ID:
retro_mputfur_1526
Organism:
Location:
GL897209.1:364216-364770 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.14 %
Coverage:
96.89 %
Frameshifts:
1
Stop codons:
7


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1526
AGGTGAAAGTGCAACTGTCTTTGATTTTCCTGAATCCAGATTTATCTGACACCCACTGCC
TCCACCATGCTGCCTAAGTTCCACCCCAATGAGATCAAAGTCATATACCTGAGACACACC
AATGGGGATGTTGGTATCACACCTGCCCTGAACCCAAAGATTGGACCCTGGATCTGTCTC
CAAAAAAGGCTCGTGATGACACCATCAAGGCAACTGGTGAATGGAAGGGTATAAGGATTA
CATGTTCTGAACTAACCATTCAGAACAGACAGGACCAGATTGAAAGTGGTACATTCTGCT
TCTTCCCTGATTATCAAAGCCCTCAAGGAACCACCAAAAGACAGAAAGAAACCAATTTTA
AGAACAGCAGAAACATTATTTTTGATGAGACTATCAAAATTGCCTGATAGTCATGGGGCT
AATCTTTAGCCAGAGAACTCTCTGGAACCATTAAAAAGATCCTGGGGGCTGCCTAAATTG
TGGACTGCAATGTTGATGGCTGCCACCCTCATTACATCATAGATGACATCAATAGTGGTA
CAATGAAATGCCCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RQRCNSLRSSRIRVHPTPATSAMPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGP-LGLSPKKVGDDIAKATGDWKGLRITV-KLTIQNRQAQIEVVPS
R..CN.L..S.I....TP..S.M.PKF.PNEIKV.YLR.T.G.VG.T.AL.PKIGP.L.LSPKK..DD..KATG.WKG.RIT...LTIQNRQ.Q.....S
Retrocopy
R*KCNCL*FS*IQIYLTPTASTMLPKFHPNEIKVIYLRHTNGDVGITPALNPKIGP/LDLSPKKARDDTIKATGEWKGIRITCSELTIQNRQDQ---IES


Parental protein
ASALIIKALKEPPRDRKKQKNSAVKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECP
...........P....K.QK....K.S.NI.FDE...IA......SLARELSGTIK.ILG.A..V.CNVDG.HPH.IIDDINSG...CP
Retrocopy
GTFCFFPDYQSPQGTTKRQKETNFKNSRNIIFDETIKIA**SWG*SLARELSGTIKKILGAA*IVDCNVDGCHPHYIIDDINSGTMKCP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide