RetrogeneDB ID:
retro_mputfur_1529
Organism:
Location:
GL897212.1:227898-228168 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.76 %
Coverage:
72.66 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
H2AFZ
Parental gene aliases:
No gene alias available
Parental gene description:
H2A histone family, member Z [Source:HGNC Symbol;Acc:4741]

Genomic region (view in browser)





>retro_mputfur_1529
CACCTGAAATCTGGAATGACTGGCTGTTGGCATGAGGGCATGATGGCCACCGTGTACTGT
GCAACCATATTGGAGAACCTCATCATGGAGATACTTGAACTGGCAGGAAATGCATCAGAG
GACTAAAAGGTAAAGAGCATTAATACTAATCACTTACATCTTGCTATTTGTGGAGTGCAA
GAATTGGACTCTGTCATCAAAGGTGTAGTTGTTACCATTCAGCACACCCATAGATCTCTG
ATGGAGAAAACAAGACAACCAAAGACTGTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
HLKS..T.....G..A.VY.A.ILE.L..E.LELAGNAS.D.KVK.I...HL.LAI.G..ELDS.IK........I.H.H.SL..K..Q.KTV
Retrocopy
HLKSGMTGCWHEGMMATVYCATILENLIMEILELAGNASED*KVKSINTNHLHLAICGVQELDSVIKGVVV---TIQHTHRSLMEKTRQPKTV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide