RetrogeneDB ID:
retro_mputfur_1530
Organism:
Location:
GL897213.1:423446-423678 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.75 %
Coverage:
57.35 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL27
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L27 [Source:HGNC Symbol;Acc:10328]

Genomic region (view in browser)





>retro_mputfur_1530
GGCTATGAGAAAATCACCAAGAGGTTAAAGGTTAAGTCTTTTATGAAAGTTTGTAACTAC
AACCACTTCATGCCCACGAGATACTCTGTGGATATCCCCTGGGACAAAACTATCATCAAC
AGGATGTCTTCAGAGACCCTGCGCTTAAATGCAAGGCCCAACAAGAGGCCAAGGTCAAGT
TAAAGGAGAGATACAAGACTGGCAAGAACAAATGGCTTTCCAGAAGCTGCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNK-DVFRDPALKRKARREAKVKFEERYKTGKNKWF-FQKLR
G..KI.KR.K.KSF.KV.NYNH.MPTRYSVDIP.DKT..N..DVFRDPALK.KA..EAKVK..ERYKTGKNKW..FQKL.
Retrocopy
GYEKITKRLKVKSFMKVCNYNHFMPTRYSVDIPWDKTIINR/DVFRDPALKCKAQQEAKVKLKERYKTGKNKWL/FQKLQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide